Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-PHD |
Location | 4078014..4078657 | Replicon | chromosome |
Accession | NZ_CP101987 | ||
Organism | Cellulomonas xiejunii strain zg-B89 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NP048_RS18785 | Protein ID | WP_227576839.1 |
Coordinates | 4078014..4078397 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NP048_RS18790 | Protein ID | WP_227576840.1 |
Coordinates | 4078394..4078657 (-) | Length | 88 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP048_RS18755 (NP048_18755) | 4073058..4073774 | - | 717 | WP_227576834.1 | ABC transporter ATP-binding protein | - |
NP048_RS18760 (NP048_18760) | 4073771..4074544 | - | 774 | WP_256769376.1 | ABC transporter ATP-binding protein | - |
NP048_RS18765 (NP048_18765) | 4074647..4075378 | - | 732 | WP_227576836.1 | glucose 1-dehydrogenase | - |
NP048_RS18770 (NP048_18770) | 4075450..4076430 | - | 981 | WP_227576837.1 | NADPH:quinone oxidoreductase family protein | - |
NP048_RS18775 (NP048_18775) | 4076436..4077077 | - | 642 | WP_227576838.1 | TetR/AcrR family transcriptional regulator | - |
NP048_RS18780 (NP048_18780) | 4077088..4077852 | - | 765 | WP_227577210.1 | SDR family oxidoreductase | - |
NP048_RS18785 (NP048_18785) | 4078014..4078397 | - | 384 | WP_227576839.1 | PIN domain-containing protein | Toxin |
NP048_RS18790 (NP048_18790) | 4078394..4078657 | - | 264 | WP_227576840.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
NP048_RS18795 (NP048_18795) | 4078939..4079142 | + | 204 | WP_227576841.1 | hypothetical protein | - |
NP048_RS18800 (NP048_18800) | 4079372..4080476 | + | 1105 | Protein_3695 | crosslink repair DNA glycosylase YcaQ family protein | - |
NP048_RS18805 (NP048_18805) | 4080542..4080688 | - | 147 | WP_227576842.1 | helix-turn-helix domain-containing protein | - |
NP048_RS18810 (NP048_18810) | 4080936..4082534 | - | 1599 | WP_227576843.1 | TROVE domain-containing protein | - |
NP048_RS18815 (NP048_18815) | 4083260..4083628 | + | 369 | WP_227576844.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 13223.16 Da Isoelectric Point: 5.0863
>T253070 WP_227576839.1 NZ_CP101987:c4078397-4078014 [Cellulomonas xiejunii]
VRLVLDTNVLIDGLVPTGTGDEAAISMATLAELRFGVLIARTAESRSARMRVLSSAESALAALPIDDAVASSYALLATKT
VAAGRQPRARAFDLLIAATAHAHGAALVTRNIDDFTGLDDVLDVRLP
VRLVLDTNVLIDGLVPTGTGDEAAISMATLAELRFGVLIARTAESRSARMRVLSSAESALAALPIDDAVASSYALLATKT
VAAGRQPRARAFDLLIAATAHAHGAALVTRNIDDFTGLDDVLDVRLP
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|