Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1371083..1371669 | Replicon | chromosome |
Accession | NZ_CP101986 | ||
Organism | Streptococcus mutans strain COCC33-14 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NPS16_RS06320 | Protein ID | WP_002290797.1 |
Coordinates | 1371478..1371669 (-) | Length | 64 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NPS16_RS06315 | Protein ID | WP_032526274.1 |
Coordinates | 1371083..1371460 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPS16_RS06305 (NPS16_06305) | 1367927..1368211 | - | 285 | WP_258968833.1 | helix-turn-helix transcriptional regulator | - |
NPS16_RS06310 (NPS16_06310) | 1368527..1369420 | + | 894 | WP_002272311.1 | LexA family transcriptional regulator IrvR | - |
NPS16_RS06315 (NPS16_06315) | 1371083..1371460 | - | 378 | WP_032526274.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NPS16_RS06320 (NPS16_06320) | 1371478..1371669 | - | 192 | WP_002290797.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NPS16_RS06325 (NPS16_06325) | 1371766..1372428 | - | 663 | WP_258968834.1 | type II-A CRISPR-associated protein Csn2 | - |
NPS16_RS06330 (NPS16_06330) | 1372418..1372762 | - | 345 | WP_002263547.1 | CRISPR-associated endonuclease Cas2 | - |
NPS16_RS06335 (NPS16_06335) | 1372759..1373625 | - | 867 | WP_014677910.1 | type II CRISPR-associated endonuclease Cas1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 64 a.a. Molecular weight: 7227.53 Da Isoelectric Point: 10.2062
>T253068 WP_002290797.1 NZ_CP101986:c1371669-1371478 [Streptococcus mutans]
MPLTGKELARLAINNGWEEVRVRESHHDFKKDGVPYIVTIPIHGNKVLKIGLEKKLLRDLNLL
MPLTGKELARLAINNGWEEVRVRESHHDFKKDGVPYIVTIPIHGNKVLKIGLEKKLLRDLNLL
Download Length: 192 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14321.29 Da Isoelectric Point: 4.5628
>AT253068 WP_032526274.1 NZ_CP101986:c1371460-1371083 [Streptococcus mutans]
MLKSYPAIFHKEEEGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGMKLPNPSEIRKLSVEDGFATMIQADP
NPYLKNNKAIRKNVTVPEWLVQLADRDQVNYSEVLTKALERKLQL
MLKSYPAIFHKEEEGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGMKLPNPSEIRKLSVEDGFATMIQADP
NPYLKNNKAIRKNVTVPEWLVQLADRDQVNYSEVLTKALERKLQL
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|