Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 165408..165979 | Replicon | chromosome |
Accession | NZ_CP101986 | ||
Organism | Streptococcus mutans strain COCC33-14 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A2J9QC66 |
Locus tag | NPS16_RS00835 | Protein ID | WP_002265705.1 |
Coordinates | 165647..165979 (+) | Length | 111 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2J9QC51 |
Locus tag | NPS16_RS00830 | Protein ID | WP_002264866.1 |
Coordinates | 165408..165653 (+) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPS16_RS00805 (NPS16_00805) | 160912..161888 | - | 977 | Protein_137 | cell division protein FtsK | - |
NPS16_RS00810 (NPS16_00810) | 161888..162202 | - | 315 | WP_002272250.1 | hypothetical protein | - |
NPS16_RS00815 (NPS16_00815) | 162402..163319 | + | 918 | WP_002272249.1 | hypothetical protein | - |
NPS16_RS00820 (NPS16_00820) | 163513..163671 | + | 159 | Protein_140 | DNA cytosine methyltransferase | - |
NPS16_RS00825 (NPS16_00825) | 163746..164900 | + | 1155 | WP_226718267.1 | protein kinase family protein | - |
NPS16_RS00830 (NPS16_00830) | 165408..165653 | + | 246 | WP_002264866.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NPS16_RS00835 (NPS16_00835) | 165647..165979 | + | 333 | WP_002265705.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NPS16_RS00840 (NPS16_00840) | 166177..166968 | - | 792 | WP_002265704.1 | nucleotidyltransferase domain-containing protein | - |
NPS16_RS00845 (NPS16_00845) | 167284..169044 | + | 1761 | WP_002265703.1 | PDZ domain-containing protein | - |
NPS16_RS00850 (NPS16_00850) | 169046..169663 | + | 618 | WP_002265702.1 | response regulator transcription factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 12632.50 Da Isoelectric Point: 6.4634
>T253067 WP_002265705.1 NZ_CP101986:165647-165979 [Streptococcus mutans]
VVTIKQGSIIKINLDPKQGHEQKGYRPYICLNHSIVTKYSNIAIFAPISNTKRDYPFYVPLEGTESTGKVLLDQLVTIDF
NARDYRYVEDIQEDLLDELLARVKVLFEKG
VVTIKQGSIIKINLDPKQGHEQKGYRPYICLNHSIVTKYSNIAIFAPISNTKRDYPFYVPLEGTESTGKVLLDQLVTIDF
NARDYRYVEDIQEDLLDELLARVKVLFEKG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9QC66 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J9QC51 |