Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 1329644..1330230 | Replicon | chromosome |
Accession | NZ_CP101984 | ||
Organism | Streptococcus mutans strain UA-159 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NPS18_RS06500 | Protein ID | WP_002263545.1 |
Coordinates | 1330039..1330230 (-) | Length | 64 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | Q8DTE7 |
Locus tag | NPS18_RS06495 | Protein ID | WP_002263544.1 |
Coordinates | 1329644..1330021 (-) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NPS18_RS06470 (NPS18_06470) | 1325045..1325173 | - | 129 | WP_002262718.1 | hypothetical protein | - |
NPS18_RS06475 (NPS18_06475) | 1325208..1325438 | - | 231 | WP_002282891.1 | hypothetical protein | - |
NPS18_RS06480 (NPS18_06480) | 1325568..1327319 | - | 1752 | WP_002262719.1 | GbpC/Spa domain-containing protein | - |
NPS18_RS06485 (NPS18_06485) | 1327482..1327767 | - | 286 | Protein_1247 | helix-turn-helix transcriptional regulator | - |
NPS18_RS06490 (NPS18_06490) | 1328082..1328975 | + | 894 | WP_002262721.1 | LexA family transcriptional regulator IrvR | - |
NPS18_RS06495 (NPS18_06495) | 1329644..1330021 | - | 378 | WP_002263544.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NPS18_RS06500 (NPS18_06500) | 1330039..1330230 | - | 192 | WP_002263545.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NPS18_RS06505 (NPS18_06505) | 1330327..1330989 | - | 663 | WP_002263546.1 | type II-A CRISPR-associated protein Csn2 | - |
NPS18_RS06510 (NPS18_06510) | 1330979..1331323 | - | 345 | WP_002263547.1 | CRISPR-associated endonuclease Cas2 | - |
NPS18_RS06515 (NPS18_06515) | 1331320..1332186 | - | 867 | WP_002352326.1 | type II CRISPR-associated endonuclease Cas1 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 64 a.a. Molecular weight: 7139.47 Da Isoelectric Point: 10.6223
>T253061 WP_002263545.1 NZ_CP101984:c1330230-1330039 [Streptococcus mutans]
MPLTGKELAKLAINNGWEEVRVRGSHHHFKKDGVSYIVTIPIHGNKVLKIGLEKKLLRDLNLL
MPLTGKELAKLAINNGWEEVRVRGSHHHFKKDGVSYIVTIPIHGNKVLKIGLEKKLLRDLNLL
Download Length: 192 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 14264.31 Da Isoelectric Point: 4.5540
>AT253061 WP_002263544.1 NZ_CP101984:c1330021-1329644 [Streptococcus mutans]
MLKSYPVIFHKEEEGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGLVLPISSDIQKISVEDGFATMIQADP
SPYLKNNKAIRKNVTVPEWLIRLADRDRVNYSEVLTKALEKKLQL
MLKSYPVIFHKEEEGYWVEFPEFGGGTQGEDLEEAMKNARQMLESVLASYLDEGLVLPISSDIQKISVEDGFATMIQADP
SPYLKNNKAIRKNVTVPEWLIRLADRDRVNYSEVLTKALEKKLQL
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|