Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 3996264..3996889 | Replicon | chromosome |
Accession | NZ_CP101940 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 974 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NP448_RS19710 | Protein ID | WP_000911337.1 |
Coordinates | 3996491..3996889 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | C0PXM4 |
Locus tag | NP448_RS19705 | Protein ID | WP_000557545.1 |
Coordinates | 3996264..3996491 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP448_RS19675 (3991327) | 3991327..3992425 | + | 1099 | WP_010989230.1 | peptide chain release factor 2 | - |
NP448_RS19680 (3992435) | 3992435..3993952 | + | 1518 | WP_000003339.1 | lysine--tRNA ligase | - |
NP448_RS19685 (3994028) | 3994028..3994573 | - | 546 | WP_050067887.1 | isopentenyl-diphosphate Delta-isomerase | - |
NP448_RS19690 (3994838) | 3994838..3995596 | + | 759 | WP_077947050.1 | amidase activator ActS | - |
NP448_RS19700 (3995842) | 3995842..3996055 | - | 214 | Protein_3835 | hypothetical protein | - |
NP448_RS19705 (3996264) | 3996264..3996491 | + | 228 | WP_000557545.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NP448_RS19710 (3996491) | 3996491..3996889 | + | 399 | WP_000911337.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
NP448_RS19715 (3997690) | 3997690..3998226 | + | 537 | WP_058652987.1 | STM3031 family outer membrane protein | - |
NP448_RS19720 (3998273) | 3998273..3998905 | + | 633 | WP_000835265.1 | YfdX family protein | - |
NP448_RS19725 (3999624) | 3999624..4000208 | + | 585 | WP_001244638.1 | fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 3996264..4004680 | 8416 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15037.43 Da Isoelectric Point: 7.7785
>T253053 WP_000911337.1 NZ_CP101940:3996491-3996889 [Salmonella enterica subsp. enterica]
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
MLKFMLDTNTCIFTIKNKPEHIRERFNLNTSRMCISSITLMELIYGAEKSLAPERNLAVVEGFISRLEVLDYDTQAAIHT
GQIRAELARKGTPVGPYDQMIAGHARSRGLVVVTNNLREFERIPGIRIEDWC
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|