Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 3986503..3987163 | Replicon | chromosome |
| Accession | NZ_CP101940 | ||
| Organism | Salmonella enterica subsp. enterica strain QA-1986 974 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | Q57K70 |
| Locus tag | NP448_RS19650 | Protein ID | WP_000244756.1 |
| Coordinates | 3986750..3987163 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S5MU13 |
| Locus tag | NP448_RS19645 | Protein ID | WP_000351186.1 |
| Coordinates | 3986503..3986769 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP448_RS19625 (3982432) | 3982432..3983865 | - | 1434 | WP_001230140.1 | 6-phospho-beta-glucosidase BglA | - |
| NP448_RS19630 (3984023) | 3984023..3984334 | + | 312 | WP_001182976.1 | N(4)-acetylcytidine aminohydrolase | - |
| NP448_RS19635 (3984498) | 3984498..3985157 | + | 660 | WP_000250289.1 | hemolysin III family protein | - |
| NP448_RS19640 (3985273) | 3985273..3986253 | - | 981 | WP_058652990.1 | tRNA-modifying protein YgfZ | - |
| NP448_RS19645 (3986503) | 3986503..3986769 | + | 267 | WP_000351186.1 | FAD assembly factor SdhE | Antitoxin |
| NP448_RS19650 (3986750) | 3986750..3987163 | + | 414 | WP_000244756.1 | protein YgfX | Toxin |
| NP448_RS19655 (3987216) | 3987216..3987737 | - | 522 | WP_001055885.1 | flavodoxin FldB | - |
| NP448_RS19660 (3987850) | 3987850..3988746 | + | 897 | WP_000434302.1 | site-specific tyrosine recombinase XerD | - |
| NP448_RS19665 (3988770) | 3988770..3989483 | + | 714 | WP_000745614.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NP448_RS19670 (3989489) | 3989489..3991222 | + | 1734 | WP_000813394.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16183.15 Da Isoelectric Point: 10.7537
>T253052 WP_000244756.1 NZ_CP101940:3986750-3987163 [Salmonella enterica subsp. enterica]
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
VVLWQSDLRVSWRAQWISLLIHGLVAAVILLMPWPLSYTPLWMILLSLVVFDCVRSQRRINTCQGEIKLLMDGRLRWQGQ
DWTLLRPPWLLKSGMVLRLRAESGRHQHLWLAADSMEEAEWRELRRILLQQPISGQH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3Z1E9V5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5I0YWH4 |