253050

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 3435712..3436298 Replicon chromosome
Accession NZ_CP101940
Organism Salmonella enterica subsp. enterica strain QA-1986 974

Toxin (Protein)


Gene name doc Uniprot ID E8XF70
Locus tag NP448_RS16865 Protein ID WP_001521773.1
Coordinates 3435930..3436298 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID M7SDJ3
Locus tag NP448_RS16860 Protein ID WP_001520924.1
Coordinates 3435712..3435933 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP448_RS16835 (3430732) 3430732..3431841 + 1110 WP_023250616.1 high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK -
NP448_RS16840 (3431901) 3431901..3432827 + 927 WP_000003007.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NP448_RS16845 (3432824) 3432824..3434101 + 1278 WP_000803766.1 branched chain amino acid ABC transporter permease LivM -
NP448_RS16850 (3434098) 3434098..3434865 + 768 WP_000082083.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NP448_RS16855 (3434867) 3434867..3435580 + 714 WP_000416114.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NP448_RS16860 (3435712) 3435712..3435933 + 222 WP_001520924.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NP448_RS16865 (3435930) 3435930..3436298 + 369 WP_001521773.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NP448_RS16870 (3436557) 3436557..3437873 + 1317 WP_000624747.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NP448_RS16875 (3437937) 3437937..3438824 + 888 WP_000099303.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NP448_RS16880 (3438821) 3438821..3439666 + 846 WP_000572196.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NP448_RS16885 (3439668) 3439668..3440738 + 1071 WP_000907838.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3425490..3441475 15985


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(24-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-49)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13587.92 Da        Isoelectric Point: 7.3190

>T253050 WP_001521773.1 NZ_CP101940:3435930-3436298 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8152.14 Da        Isoelectric Point: 5.0775

>AT253050 WP_001520924.1 NZ_CP101940:3435712-3435933 [Salmonella enterica subsp. enterica]
MRTVNYSEARQNLAEVLESAVTGGPVTITRRGHKSAVIISAEEFERYQTARMDDEFAAIMAVHGNELRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A607IPC3

Antitoxin

Source ID Structure
AlphaFold DB A0A6C6Z871

References