Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 3435712..3436298 | Replicon | chromosome |
| Accession | NZ_CP101940 | ||
| Organism | Salmonella enterica subsp. enterica strain QA-1986 974 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | E8XF70 |
| Locus tag | NP448_RS16865 | Protein ID | WP_001521773.1 |
| Coordinates | 3435930..3436298 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | M7SDJ3 |
| Locus tag | NP448_RS16860 | Protein ID | WP_001520924.1 |
| Coordinates | 3435712..3435933 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP448_RS16835 (3430732) | 3430732..3431841 | + | 1110 | WP_023250616.1 | high-affinity branched-chain amino acid ABC transporter substrate-binding protein LivK | - |
| NP448_RS16840 (3431901) | 3431901..3432827 | + | 927 | WP_000003007.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| NP448_RS16845 (3432824) | 3432824..3434101 | + | 1278 | WP_000803766.1 | branched chain amino acid ABC transporter permease LivM | - |
| NP448_RS16850 (3434098) | 3434098..3434865 | + | 768 | WP_000082083.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| NP448_RS16855 (3434867) | 3434867..3435580 | + | 714 | WP_000416114.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| NP448_RS16860 (3435712) | 3435712..3435933 | + | 222 | WP_001520924.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NP448_RS16865 (3435930) | 3435930..3436298 | + | 369 | WP_001521773.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| NP448_RS16870 (3436557) | 3436557..3437873 | + | 1317 | WP_000624747.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| NP448_RS16875 (3437937) | 3437937..3438824 | + | 888 | WP_000099303.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| NP448_RS16880 (3438821) | 3438821..3439666 | + | 846 | WP_000572196.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| NP448_RS16885 (3439668) | 3439668..3440738 | + | 1071 | WP_000907838.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 3425490..3441475 | 15985 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13587.92 Da Isoelectric Point: 7.3190
>T253050 WP_001521773.1 NZ_CP101940:3435930-3436298 [Salmonella enterica subsp. enterica]
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
MTLQLISAEEIIQFHDRLLRVTPGVTGMPDPGRAEALMYRVLKQIEYEGVTDVWLLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGISLAANPDFVDMTVDAAAGRLTLEQIAVRLRA
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A607IPC3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6C6Z871 |