Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 2568848..2569629 | Replicon | chromosome |
| Accession | NZ_CP101940 | ||
| Organism | Salmonella enterica subsp. enterica strain QA-1986 974 | ||
Toxin (Protein)
| Gene name | TacT2 | Uniprot ID | A0A3G3E5T9 |
| Locus tag | NP448_RS12720 | Protein ID | WP_000625911.1 |
| Coordinates | 2568848..2569339 (-) | Length | 164 a.a. |
Antitoxin (Protein)
| Gene name | TacA2 | Uniprot ID | V7IUD2 |
| Locus tag | NP448_RS12725 | Protein ID | WP_001271379.1 |
| Coordinates | 2569336..2569629 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP448_RS12695 (2565728) | 2565728..2566558 | - | 831 | WP_023221225.1 | fimbria/pilus periplasmic chaperone | - |
| NP448_RS12700 (2566760) | 2566760..2566972 | - | 213 | WP_001293880.1 | PapB/FocB family fimbrial expression transcriptional regulator | - |
| NP448_RS12705 (2567598) | 2567598..2567741 | + | 144 | Protein_2482 | transposase | - |
| NP448_RS12710 (2567758) | 2567758..2568104 | + | 347 | Protein_2483 | Rpn family recombination-promoting nuclease/putative transposase | - |
| NP448_RS12715 (2568385) | 2568385..2568633 | - | 249 | Protein_2484 | IS481 family transposase | - |
| NP448_RS12720 (2568848) | 2568848..2569339 | - | 492 | WP_000625911.1 | GNAT family N-acetyltransferase | Toxin |
| NP448_RS12725 (2569336) | 2569336..2569629 | - | 294 | WP_001271379.1 | DUF1778 domain-containing protein | Antitoxin |
| NP448_RS12730 (2569947) | 2569947..2570169 | + | 223 | Protein_2487 | hypothetical protein | - |
| NP448_RS12735 (2570435) | 2570435..2571310 | + | 876 | WP_058653569.1 | AraC family transcriptional regulator | - |
| NP448_RS12740 (2571307) | 2571307..2571594 | + | 288 | WP_001269916.1 | transcriptional regulator RtsB | - |
| NP448_RS12745 (2571587) | 2571587..2571769 | - | 183 | WP_071591272.1 | ATP-binding cassette domain-containing protein | - |
| NP448_RS12750 (2571789) | 2571789..2571888 | + | 100 | Protein_2491 | hypothetical protein | - |
| NP448_RS12755 (2571996) | 2571996..2572130 | + | 135 | Protein_2492 | hypothetical protein | - |
| NP448_RS12760 (2572425) | 2572425..2573330 | - | 906 | WP_058653032.1 | YjiK family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 2558240..2571594 | 13354 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17663.44 Da Isoelectric Point: 7.2655
>T253047 WP_000625911.1 NZ_CP101940:c2569339-2568848 [Salmonella enterica subsp. enterica]
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
MISSPEPLHAGHILTPFCCGVDSMDNWLKQRAMKNQTTGASRTFVCCGSDSNVLAYYSLASSAVTTNTAPGRFRRNMPDP
IPIVVLGRLAVDKSLHGQGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEAREFYQRVGFEPSPMDPMMLMVTLGDLV
ESV
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A3G3E5T9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V7IUD2 |