Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2431216..2431732 | Replicon | chromosome |
Accession | NZ_CP101940 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 974 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A7U1KST9 |
Locus tag | NP448_RS12000 | Protein ID | WP_000220585.1 |
Coordinates | 2431216..2431500 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A7U1KSR8 |
Locus tag | NP448_RS12005 | Protein ID | WP_000212721.1 |
Coordinates | 2431490..2431732 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP448_RS11985 (2426332) | 2426332..2427984 | + | 1653 | WP_023993572.1 | alpha,alpha-phosphotrehalase | - |
NP448_RS11990 (2428393) | 2428393..2430531 | + | 2139 | WP_000187818.1 | anaerobic ribonucleoside-triphosphate reductase | - |
NP448_RS11995 (2430748) | 2430748..2431212 | + | 465 | WP_001009173.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
NP448_RS12000 (2431216) | 2431216..2431500 | - | 285 | WP_000220585.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP448_RS12005 (2431490) | 2431490..2431732 | - | 243 | WP_000212721.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
NP448_RS12010 (2431810) | 2431810..2433723 | - | 1914 | WP_001212145.1 | BglG family transcription antiterminator | - |
NP448_RS12015 (2433740) | 2433740..2434480 | - | 741 | WP_023229489.1 | KDGP aldolase family protein | - |
NP448_RS12020 (2434477) | 2434477..2435595 | - | 1119 | WP_023256352.1 | DgaE family pyridoxal phosphate-dependent ammonia lyase | - |
NP448_RS12025 (2435579) | 2435579..2436712 | - | 1134 | WP_023257225.1 | amidohydrolase/deacetylase family metallohydrolase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10878.69 Da Isoelectric Point: 9.8739
>T253046 WP_000220585.1 NZ_CP101940:c2431500-2431216 [Salmonella enterica subsp. enterica]
MTYELEIDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
MTYELEIDPRALKEWHKLGDTVKAQLKKKLADVLLNPRIDSARLNDLPDCYKIKLKSSGYRLVYQVRDDVVIVFVVAVGK
REHSAVYHDANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1KST9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U1KSR8 |