Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 2389237..2389787 | Replicon | chromosome |
Accession | NZ_CP101940 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 974 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | M7RJ32 |
Locus tag | NP448_RS11785 | Protein ID | WP_001199743.1 |
Coordinates | 2389237..2389545 (-) | Length | 103 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | M7RP97 |
Locus tag | NP448_RS11790 | Protein ID | WP_001118105.1 |
Coordinates | 2389548..2389787 (-) | Length | 80 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP448_RS11770 (2387261) | 2387261..2388040 | - | 780 | WP_058653113.1 | HNH endonuclease | - |
NP448_RS11775 (2388201) | 2388201..2388515 | + | 315 | WP_058653112.1 | hypothetical protein | - |
NP448_RS11780 (2388512) | 2388512..2388801 | - | 290 | Protein_2302 | Arm DNA-binding domain-containing protein | - |
NP448_RS11785 (2389237) | 2389237..2389545 | - | 309 | WP_001199743.1 | CcdB family protein | Toxin |
NP448_RS11790 (2389548) | 2389548..2389787 | - | 240 | WP_001118105.1 | type II toxin-antitoxin system CcdA family antitoxin | Antitoxin |
NP448_RS11795 (2389896) | 2389896..2390144 | - | 249 | WP_000168388.1 | ribbon-helix-helix domain-containing protein | - |
NP448_RS11800 (2390221) | 2390221..2390529 | - | 309 | Protein_2306 | DUF4942 domain-containing protein | - |
NP448_RS11805 (2390549) | 2390549..2391526 | - | 978 | WP_223156503.1 | IS630 family transposase | - |
NP448_RS11815 (2392284) | 2392284..2393303 | + | 1020 | WP_000152563.1 | NAD(P)-dependent alcohol dehydrogenase | - |
NP448_RS11820 (2393331) | 2393331..2393861 | - | 531 | WP_000896756.1 | gluconokinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 2390549..2391481 | 932 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11845.67 Da Isoelectric Point: 6.7228
>T253045 WP_001199743.1 NZ_CP101940:c2389545-2389237 [Salmonella enterica subsp. enterica]
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
MQYMVYRNKGNSKAYPYLLDVQSDIIDELHTRMVIPLFPVSRLVNNPVKRLTPTLNVEGNDYLVMTHEMASIRLSQIGDE
VMDVRSHRQTIKNALDFIFDGF
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6C6Z9V9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5H9SZK8 |