Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1724608..1725228 | Replicon | chromosome |
Accession | NZ_CP101940 | ||
Organism | Salmonella enterica subsp. enterica strain QA-1986 974 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | V1H8E6 |
Locus tag | NP448_RS08800 | Protein ID | WP_001280991.1 |
Coordinates | 1725010..1725228 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | V1H4V6 |
Locus tag | NP448_RS08795 | Protein ID | WP_000344807.1 |
Coordinates | 1724608..1724982 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP448_RS08785 (1719747) | 1719747..1720940 | + | 1194 | WP_001039200.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NP448_RS08790 (1720963) | 1720963..1724112 | + | 3150 | WP_001132508.1 | efflux RND transporter permease AcrB | - |
NP448_RS08795 (1724608) | 1724608..1724982 | + | 375 | WP_000344807.1 | Hha toxicity modulator TomB | Antitoxin |
NP448_RS08800 (1725010) | 1725010..1725228 | + | 219 | WP_001280991.1 | HHA domain-containing protein | Toxin |
NP448_RS08805 (1725407) | 1725407..1725958 | + | 552 | WP_001278792.1 | maltose O-acetyltransferase | - |
NP448_RS08810 (1726075) | 1726075..1726545 | + | 471 | WP_000136181.1 | YlaC family protein | - |
NP448_RS08815 (1726601) | 1726601..1726741 | - | 141 | WP_001197749.1 | type B 50S ribosomal protein L36 | - |
NP448_RS08820 (1726747) | 1726747..1727007 | - | 261 | WP_000801421.1 | type B 50S ribosomal protein L31 | - |
NP448_RS08825 (1727232) | 1727232..1728782 | + | 1551 | WP_000213145.1 | EAL domain-containing protein | - |
NP448_RS08835 (1729013) | 1729013..1729402 | + | 390 | WP_000961285.1 | MGMT family protein | - |
NP448_RS08840 (1729435) | 1729435..1730004 | - | 570 | WP_000779803.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8613.97 Da Isoelectric Point: 8.9008
>T253043 WP_001280991.1 NZ_CP101940:1725010-1725228 [Salmonella enterica subsp. enterica]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14453.27 Da Isoelectric Point: 5.1444
>AT253043 WP_000344807.1 NZ_CP101940:1724608-1724982 [Salmonella enterica subsp. enterica]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYNEDNKLIAQIDEYL
DDTFMLFSSYGINTQDLQKWRKSGNRLFRCFVNATRANPVSLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|