Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 561416..562052 | Replicon | chromosome |
Accession | NZ_CP101938 | ||
Organism | Bacillus altitudinis strain BDGP7 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | K2MHT4 |
Locus tag | NP445_RS02765 | Protein ID | WP_003214169.1 |
Coordinates | 561702..562052 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A267X601 |
Locus tag | NP445_RS02760 | Protein ID | WP_012008995.1 |
Coordinates | 561416..561697 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP445_RS02740 (NP445_02740) | 557562..558167 | - | 606 | WP_007496491.1 | rhomboid family intramembrane serine protease | - |
NP445_RS02745 (NP445_02745) | 558262..558627 | + | 366 | WP_017366663.1 | holo-ACP synthase | - |
NP445_RS02750 (NP445_02750) | 558788..559804 | + | 1017 | WP_007496489.1 | outer membrane lipoprotein-sorting protein | - |
NP445_RS02755 (NP445_02755) | 559940..561121 | + | 1182 | WP_256689026.1 | alanine racemase | - |
NP445_RS02760 (NP445_02760) | 561416..561697 | + | 282 | WP_012008995.1 | hypothetical protein | Antitoxin |
NP445_RS02765 (NP445_02765) | 561702..562052 | + | 351 | WP_003214169.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NP445_RS02770 (NP445_02770) | 562167..562997 | + | 831 | WP_017358395.1 | RsbT co-antagonist protein RsbRA | - |
NP445_RS02775 (NP445_02775) | 563002..563370 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
NP445_RS02780 (NP445_02780) | 563373..563774 | + | 402 | WP_003214085.1 | anti-sigma regulatory factor | - |
NP445_RS02785 (NP445_02785) | 563785..564792 | + | 1008 | WP_061418047.1 | PP2C family protein-serine/threonine phosphatase | - |
NP445_RS02790 (NP445_02790) | 564852..565181 | + | 330 | WP_017358393.1 | anti-sigma factor antagonist | - |
NP445_RS02795 (NP445_02795) | 565178..565666 | + | 489 | WP_024719203.1 | anti-sigma B factor RsbW | - |
NP445_RS02800 (NP445_02800) | 565632..566420 | + | 789 | WP_012009000.1 | RNA polymerase sigma factor SigB | - |
NP445_RS02805 (NP445_02805) | 566420..567019 | + | 600 | WP_024719202.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12976.99 Da Isoelectric Point: 5.1663
>T253037 WP_003214169.1 NZ_CP101938:561702-562052 [Bacillus altitudinis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEINAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | K2MHT4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A267X601 |