Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1327421..1328337 | Replicon | chromosome |
Accession | NZ_CP101937 | ||
Organism | Bacillus subtilis strain RUB331 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NP435_RS06965 | Protein ID | WP_003244695.1 |
Coordinates | 1327591..1328337 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NP435_RS06960 | Protein ID | WP_003232646.1 |
Coordinates | 1327421..1327591 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP435_RS06925 (1324284) | 1324284..1324613 | + | 330 | WP_003232660.1 | XkdW family protein | - |
NP435_RS06930 (1324610) | 1324610..1324774 | + | 165 | WP_003232658.1 | XkdX family protein | - |
NP435_RS06935 (1324818) | 1324818..1325657 | + | 840 | WP_003245597.1 | phage-like element PBSX protein XepA | - |
NP435_RS06940 (1325710) | 1325710..1325979 | + | 270 | WP_003232655.1 | hemolysin XhlA family protein | - |
NP435_RS06945 (1325992) | 1325992..1326255 | + | 264 | WP_003232653.1 | phage holin | - |
NP435_RS06950 (1326268) | 1326268..1327161 | + | 894 | WP_003245230.1 | N-acetylmuramoyl-L-alanine amidase | - |
NP435_RS06955 (1327198) | 1327198..1327335 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NP435_RS06960 (1327421) | 1327421..1327591 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NP435_RS06965 (1327591) | 1327591..1328337 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NP435_RS06970 (1328447) | 1328447..1329448 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
NP435_RS06975 (1329461) | 1329461..1330078 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NP435_RS06980 (1330354) | 1330354..1331670 | - | 1317 | WP_003244819.1 | serine/threonine exchanger | - |
NP435_RS06985 (1332059) | 1332059..1333009 | + | 951 | WP_003245086.1 | ring-cleaving dioxygenase | - |
NP435_RS06990 (1333110) | 1333110..1333256 | + | 147 | WP_003244977.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T253021 WP_003244695.1 NZ_CP101937:c1328337-1327591 [Bacillus subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|