Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1320755..1321671 | Replicon | chromosome |
Accession | NZ_CP101936 | ||
Organism | Bacillus subtilis subsp. subtilis strain BGSC 10A5 |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | - |
Locus tag | NP434_RS06985 | Protein ID | WP_089172519.1 |
Coordinates | 1320925..1321671 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NP434_RS06980 | Protein ID | WP_003232646.1 |
Coordinates | 1320755..1320925 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP434_RS06940 (NP434_06940) | 1316472..1316801 | + | 330 | WP_256683382.1 | XkdW family protein | - |
NP434_RS06945 (NP434_06945) | 1316798..1316962 | + | 165 | WP_014479563.1 | XkdX family protein | - |
NP434_RS06950 (NP434_06950) | 1317006..1317845 | + | 840 | WP_256683383.1 | phage-like element PBSX protein XepA | - |
NP434_RS06955 (NP434_06955) | 1317898..1318167 | + | 270 | WP_015252265.1 | hemolysin XhlA family protein | - |
NP434_RS06960 (NP434_06960) | 1318180..1318443 | + | 264 | WP_014479566.1 | phage holin | - |
NP434_RS06965 (NP434_06965) | 1318456..1319352 | + | 897 | WP_181217006.1 | N-acetylmuramoyl-L-alanine amidase | - |
NP434_RS06970 (NP434_06970) | 1319429..1320520 | + | 1092 | WP_181217007.1 | acyltransferase family protein | - |
NP434_RS06975 (NP434_06975) | 1320517..1320669 | - | 153 | WP_181217008.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NP434_RS06980 (NP434_06980) | 1320755..1320925 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NP434_RS06985 (NP434_06985) | 1320925..1321671 | - | 747 | WP_089172519.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NP434_RS06990 (NP434_06990) | 1321781..1322782 | - | 1002 | WP_003232642.1 | inorganic phosphate transporter | - |
NP434_RS06995 (NP434_06995) | 1322795..1323412 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NP434_RS07000 (NP434_07000) | 1323688..1325004 | - | 1317 | WP_256683384.1 | serine/threonine exchanger | - |
NP434_RS07005 (NP434_07005) | 1325393..1326343 | + | 951 | WP_014476561.1 | ring-cleaving dioxygenase | - |
NP434_RS07010 (NP434_07010) | 1326453..1326554 | + | 102 | Protein_1317 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29121.60 Da Isoelectric Point: 4.6191
>T253019 WP_089172519.1 NZ_CP101936:c1321671-1320925 [Bacillus subtilis subsp. subtilis]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMFAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMFAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|