Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 525546..526182 | Replicon | chromosome |
Accession | NZ_CP101936 | ||
Organism | Bacillus subtilis subsp. subtilis strain BGSC 10A5 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NP434_RS02750 | Protein ID | WP_003156187.1 |
Coordinates | 525832..526182 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NP434_RS02745 | Protein ID | WP_003225183.1 |
Coordinates | 525546..525827 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP434_RS02725 (NP434_02725) | 521905..522504 | - | 600 | WP_123372836.1 | rhomboid family intramembrane serine protease | - |
NP434_RS02730 (NP434_02730) | 522599..522964 | + | 366 | WP_256683226.1 | holo-ACP synthase | - |
NP434_RS02735 (NP434_02735) | 523130..524146 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
NP434_RS02740 (NP434_02740) | 524261..525430 | + | 1170 | WP_017697002.1 | alanine racemase | - |
NP434_RS02745 (NP434_02745) | 525546..525827 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NP434_RS02750 (NP434_02750) | 525832..526182 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NP434_RS02755 (NP434_02755) | 526297..527121 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
NP434_RS02760 (NP434_02760) | 527126..527491 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NP434_RS02765 (NP434_02765) | 527495..527896 | + | 402 | WP_003246640.1 | serine/threonine-protein kinase RsbT | - |
NP434_RS02770 (NP434_02770) | 527908..528915 | + | 1008 | WP_003234295.1 | phosphoserine phosphatase RsbU | - |
NP434_RS02775 (NP434_02775) | 528977..529306 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
NP434_RS02780 (NP434_02780) | 529303..529785 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
NP434_RS02785 (NP434_02785) | 529751..530539 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
NP434_RS02790 (NP434_02790) | 530539..531138 | + | 600 | WP_003234303.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T253018 WP_003156187.1 NZ_CP101936:525832-526182 [Bacillus subtilis subsp. subtilis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|