Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
Location | 1366100..1367016 | Replicon | chromosome |
Accession | NZ_CP101933 | ||
Organism | Bacillus subtilis subsp. natto strain Bacillus subtilis 'natto' |
Toxin (Protein)
Gene name | spoIISA | Uniprot ID | O34853 |
Locus tag | NP437_RS07250 | Protein ID | WP_003244695.1 |
Coordinates | 1366270..1367016 (-) | Length | 249 a.a. |
Antitoxin (Protein)
Gene name | spoIISB | Uniprot ID | G4EXD8 |
Locus tag | NP437_RS07245 | Protein ID | WP_003232646.1 |
Coordinates | 1366100..1366270 (-) | Length | 57 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP437_RS07210 (NP437_07210) | 1362959..1363288 | + | 330 | WP_014479562.1 | XkdW family protein | - |
NP437_RS07215 (NP437_07215) | 1363285..1363449 | + | 165 | WP_014479563.1 | XkdX family protein | - |
NP437_RS07220 (NP437_07220) | 1363496..1364335 | + | 840 | WP_014479564.1 | phage-like element PBSX protein XepA | - |
NP437_RS07225 (NP437_07225) | 1364388..1364657 | + | 270 | WP_014479565.1 | hemolysin XhlA family protein | - |
NP437_RS07230 (NP437_07230) | 1364670..1364933 | + | 264 | WP_014479566.1 | phage holin | - |
NP437_RS07235 (NP437_07235) | 1364946..1365839 | + | 894 | WP_014479567.1 | N-acetylmuramoyl-L-alanine amidase | - |
NP437_RS07240 (NP437_07240) | 1365877..1366014 | - | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
NP437_RS07245 (NP437_07245) | 1366100..1366270 | - | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
NP437_RS07250 (NP437_07250) | 1366270..1367016 | - | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
NP437_RS07255 (NP437_07255) | 1367126..1368127 | - | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
NP437_RS07260 (NP437_07260) | 1368140..1368757 | - | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
NP437_RS07265 (NP437_07265) | 1369033..1370349 | - | 1317 | WP_014479570.1 | serine/threonine exchanger | - |
NP437_RS07270 (NP437_07270) | 1370738..1371688 | + | 951 | WP_014479571.1 | ring-cleaving dioxygenase | - |
NP437_RS07275 (NP437_07275) | 1371797..1371892 | + | 96 | Protein_1370 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T253017 WP_003244695.1 NZ_CP101933:c1367016-1366270 [Bacillus subtilis subsp. natto]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|