Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1393742..1394658 | Replicon | chromosome |
| Accession | NZ_CP101932 | ||
| Organism | Bacillus subtilis subsp. natto strain BGSC 27E1 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | O34853 |
| Locus tag | NP436_RS07315 | Protein ID | WP_003244695.1 |
| Coordinates | 1393742..1394488 (+) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | G4EXD8 |
| Locus tag | NP436_RS07320 | Protein ID | WP_003232646.1 |
| Coordinates | 1394488..1394658 (+) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP436_RS07290 (NP436_07290) | 1388866..1388961 | - | 96 | Protein_1373 | hypothetical protein | - |
| NP436_RS07295 (NP436_07295) | 1389070..1390020 | - | 951 | WP_014479571.1 | ring-cleaving dioxygenase | - |
| NP436_RS07300 (NP436_07300) | 1390409..1391725 | + | 1317 | WP_014479570.1 | serine/threonine exchanger | - |
| NP436_RS07305 (NP436_07305) | 1392001..1392618 | + | 618 | WP_003218470.1 | DUF47 domain-containing protein | - |
| NP436_RS07310 (NP436_07310) | 1392631..1393632 | + | 1002 | WP_014479569.1 | inorganic phosphate transporter | - |
| NP436_RS07315 (NP436_07315) | 1393742..1394488 | + | 747 | WP_003244695.1 | toxin-antitoxin-antitoxin system toxin SpoIISA | Toxin |
| NP436_RS07320 (NP436_07320) | 1394488..1394658 | + | 171 | WP_003232646.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISB | Antitoxin |
| NP436_RS07325 (NP436_07325) | 1394744..1394881 | + | 138 | WP_003232648.1 | three component toxin-antitoxin-antitoxin system antitoxin SpoIISC | - |
| NP436_RS07330 (NP436_07330) | 1394919..1395812 | - | 894 | WP_014479567.1 | N-acetylmuramoyl-L-alanine amidase | - |
| NP436_RS07335 (NP436_07335) | 1395825..1396088 | - | 264 | WP_014479566.1 | phage holin | - |
| NP436_RS07340 (NP436_07340) | 1396101..1396370 | - | 270 | WP_014479565.1 | hemolysin XhlA family protein | - |
| NP436_RS07345 (NP436_07345) | 1396423..1397262 | - | 840 | WP_014479564.1 | phage-like element PBSX protein XepA | - |
| NP436_RS07350 (NP436_07350) | 1397309..1397473 | - | 165 | WP_014479563.1 | XkdX family protein | - |
| NP436_RS07355 (NP436_07355) | 1397470..1397799 | - | 330 | WP_014479562.1 | XkdW family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29061.50 Da Isoelectric Point: 4.6191
>T253015 WP_003244695.1 NZ_CP101932:1393742-1394488 [Bacillus subtilis subsp. natto]
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
MVLFFQIMVWCIVAGLGLYVYATWRFEAKVKEKMSAIRKTWYLLFVLGAMVYWTYEPTSLFTHWERYLIVAVSFALIDAF
IFLSAYVKKLAGSELETDTREILEENNEMLHMYLNRLKTYQYLLKNEPIHVYYGSIDAYAEGIDKLLKTYADKMNLTASL
CHYSTQADKDRLTEHMDDPADVQTRLDRKDVYYDQYGKVVLIPFTIETQNYVIKLTSDSIVTEFDYLLFTSLTSIYDLVL
PIEEEGEG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|