Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
Location | 511422..512058 | Replicon | chromosome |
Accession | NZ_CP101932 | ||
Organism | Bacillus subtilis subsp. natto strain BGSC 27E1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | G4NU33 |
Locus tag | NP436_RS02625 | Protein ID | WP_003156187.1 |
Coordinates | 511708..512058 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | G4NU32 |
Locus tag | NP436_RS02620 | Protein ID | WP_003225183.1 |
Coordinates | 511422..511703 (+) | Length | 94 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP436_RS02600 (NP436_02600) | 507781..508380 | - | 600 | WP_014478896.1 | rhomboid family intramembrane serine protease | - |
NP436_RS02605 (NP436_02605) | 508475..508840 | + | 366 | WP_014478897.1 | holo-ACP synthase | - |
NP436_RS02610 (NP436_02610) | 509006..510022 | + | 1017 | WP_003234282.1 | outer membrane lipoprotein carrier protein LolA | - |
NP436_RS02615 (NP436_02615) | 510137..511306 | + | 1170 | WP_014478898.1 | alanine racemase | - |
NP436_RS02620 (NP436_02620) | 511422..511703 | + | 282 | WP_003225183.1 | type II toxin-antitoxin system antitoxin EndoAI | Antitoxin |
NP436_RS02625 (NP436_02625) | 511708..512058 | + | 351 | WP_003156187.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
NP436_RS02630 (NP436_02630) | 512174..512998 | + | 825 | WP_009966610.1 | RsbT co-antagonist protein RsbRA | - |
NP436_RS02635 (NP436_02635) | 513003..513368 | + | 366 | WP_003225190.1 | RsbT antagonist protein RsbS | - |
NP436_RS02640 (NP436_02640) | 513372..513773 | + | 402 | WP_014478899.1 | serine/threonine-protein kinase RsbT | - |
NP436_RS02645 (NP436_02645) | 513785..514792 | + | 1008 | WP_014478900.1 | phosphoserine phosphatase RsbU | - |
NP436_RS02650 (NP436_02650) | 514861..515190 | + | 330 | WP_003234298.1 | anti-sigma factor antagonist RsbV | - |
NP436_RS02655 (NP436_02655) | 515187..515669 | + | 483 | WP_003234299.1 | anti-sigma B factor RsbW | - |
NP436_RS02660 (NP436_02660) | 515635..516423 | + | 789 | WP_003246715.1 | RNA polymerase sigma factor SigB | - |
NP436_RS02665 (NP436_02665) | 516423..517022 | + | 600 | WP_003246608.1 | phosphoserine phosphatase RsbX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8781
>T253014 WP_003156187.1 NZ_CP101932:511708-512058 [Bacillus subtilis subsp. natto]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMDKVDEALQISLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|