Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 8037..8559 Replicon plasmid pEcFELIX377.2
Accession NZ_CP101927
Organism Escherichia coli strain Seattle 1946

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag NP429_RS25095 Protein ID WP_000220560.1
Coordinates 8278..8559 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NP429_RS25090 Protein ID WP_000121743.1
Coordinates 8037..8288 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP429_RS25065 (3196) 3196..4173 + 978 WP_001269914.1 hypothetical protein -
NP429_RS25070 (4170) 4170..4526 - 357 WP_001546351.1 DNA distortion polypeptide 3 -
NP429_RS25075 (4666) 4666..5109 - 444 WP_001074379.1 hypothetical protein -
NP429_RS25080 (5113) 5113..5955 - 843 WP_000435063.1 replication initiation protein -
NP429_RS25085 (5976) 5976..6815 - 840 WP_001546350.1 replication initiation protein -
NP429_RS25090 (8037) 8037..8288 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NP429_RS25095 (8278) 8278..8559 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NP429_RS25100 (8705) 8705..9028 + 324 WP_001181903.1 hypothetical protein -
NP429_RS25105 (9073) 9073..9318 + 246 WP_000356548.1 hypothetical protein -
NP429_RS25110 (9308) 9308..9523 + 216 WP_001180116.1 hypothetical protein -
NP429_RS25115 (9616) 9616..9945 + 330 WP_000866648.1 hypothetical protein -
NP429_RS25120 (9988) 9988..10167 + 180 WP_071526261.1 hypothetical protein -
NP429_RS25125 (10253) 10253..10402 + 150 WP_000003880.1 hypothetical protein -
NP429_RS25130 (10415) 10415..10687 + 273 WP_000160399.1 hypothetical protein -
NP429_RS25135 (10918) 10918..11271 + 354 Protein_19 H-NS histone family protein -
NP429_RS25140 (11326) 11326..11733 + 408 WP_001546356.1 hypothetical protein -
NP429_RS25145 (11990) 11990..12454 + 465 WP_001443073.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..24185 24185


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T253009 WP_000220560.1 NZ_CP101927:8278-8559 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT253009 WP_000121743.1 NZ_CP101927:8037-8288 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References