Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4419564..4420399 | Replicon | chromosome |
| Accession | NZ_CP101925 | ||
| Organism | Escherichia coli strain Seattle 1946 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | NP429_RS21350 | Protein ID | WP_000854759.1 |
| Coordinates | 4419564..4419941 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NP429_RS21355 | Protein ID | WP_001295723.1 |
| Coordinates | 4420031..4420399 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP429_RS21325 (4415675) | 4415675..4417297 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| NP429_RS21330 (4418088) | 4418088..4418264 | - | 177 | Protein_4182 | helix-turn-helix domain-containing protein | - |
| NP429_RS21335 (4418631) | 4418631..4418780 | - | 150 | Protein_4183 | hypothetical protein | - |
| NP429_RS21340 (4418886) | 4418886..4419062 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| NP429_RS21345 (4419079) | 4419079..4419567 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| NP429_RS21350 (4419564) | 4419564..4419941 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| NP429_RS21355 (4420031) | 4420031..4420399 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NP429_RS21360 (4420562) | 4420562..4420783 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| NP429_RS21365 (4420846) | 4420846..4421322 | - | 477 | WP_001186775.1 | RadC family protein | - |
| NP429_RS21370 (4421338) | 4421338..4421811 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| NP429_RS21375 (4422153) | 4422153..4422971 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| NP429_RS21380 (4423089) | 4423089..4423284 | - | 196 | Protein_4192 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4408023..4434935 | 26912 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T253005 WP_000854759.1 NZ_CP101925:c4419941-4419564 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT253005 WP_001295723.1 NZ_CP101925:c4420399-4420031 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |