Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4232214..4232764 Replicon chromosome
Accession NZ_CP101925
Organism Escherichia coli strain Seattle 1946

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag NP429_RS20430 Protein ID WP_001160966.1
Coordinates 4232214..4232528 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag NP429_RS20435 Protein ID WP_000125566.1
Coordinates 4232531..4232764 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP429_RS20405 (4227889) 4227889..4229175 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
NP429_RS20410 (4229175) 4229175..4230164 + 990 WP_000241229.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
NP429_RS20415 (4230161) 4230161..4230982 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
NP429_RS20420 (4230985) 4230985..4231362 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
NP429_RS20425 (4231369) 4231369..4232217 + 849 WP_000257182.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
NP429_RS20430 (4232214) 4232214..4232528 - 315 WP_001160966.1 CcdB family protein Toxin
NP429_RS20435 (4232531) 4232531..4232764 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
NP429_RS20440 (4232850) 4232850..4233329 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
NP429_RS20445 (4233521) 4233521..4235383 - 1863 WP_000377123.1 glutathione-regulated potassium-efflux system protein KefC -
NP429_RS20450 (4235376) 4235376..4235906 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
NP429_RS20455 (4236014) 4236014..4237345 - 1332 WP_001183207.1 MFS transporter -
NP429_RS20460 (4237404) 4237404..4237691 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T253002 WP_001160966.1 NZ_CP101925:c4232528-4232214 [Escherichia coli]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT253002 WP_000125566.1 NZ_CP101925:c4232764-4232531 [Escherichia coli]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References