Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3738230..3738848 | Replicon | chromosome |
| Accession | NZ_CP101925 | ||
| Organism | Escherichia coli strain Seattle 1946 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NP429_RS18120 | Protein ID | WP_001291435.1 |
| Coordinates | 3738630..3738848 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | NP429_RS18115 | Protein ID | WP_000344800.1 |
| Coordinates | 3738230..3738604 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP429_RS18105 (3733320) | 3733320..3734513 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NP429_RS18110 (3734536) | 3734536..3737685 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
| NP429_RS18115 (3738230) | 3738230..3738604 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| NP429_RS18120 (3738630) | 3738630..3738848 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NP429_RS18125 (3739021) | 3739021..3739572 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| NP429_RS18130 (3739688) | 3739688..3740158 | + | 471 | WP_001304825.1 | YlaC family protein | - |
| NP429_RS18135 (3740322) | 3740322..3741872 | + | 1551 | WP_001528761.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NP429_RS18140 (3741914) | 3741914..3742267 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NP429_RS18150 (3742646) | 3742646..3742957 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| NP429_RS18155 (3742988) | 3742988..3743560 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253000 WP_001291435.1 NZ_CP101925:3738630-3738848 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT253000 WP_000344800.1 NZ_CP101925:3738230-3738604 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |