Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3092855..3093689 | Replicon | chromosome |
| Accession | NZ_CP101925 | ||
| Organism | Escherichia coli strain Seattle 1946 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | NP429_RS15060 | Protein ID | WP_000854690.1 |
| Coordinates | 3092855..3093232 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | - |
| Locus tag | NP429_RS15065 | Protein ID | WP_001546171.1 |
| Coordinates | 3093321..3093689 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP429_RS15025 (3088446) | 3088446..3089000 | - | 555 | WP_001001909.1 | molecular chaperone YcdY | - |
| NP429_RS15030 (3089024) | 3089024..3089761 | - | 738 | WP_000283664.1 | zinc-binding phosphatase | - |
| NP429_RS15035 (3089816) | 3089816..3090754 | - | 939 | WP_000351287.1 | glyoxylate/hydroxypyruvate reductase GhrA | - |
| NP429_RS15045 (3091225) | 3091225..3092068 | - | 844 | Protein_2955 | DUF4942 domain-containing protein | - |
| NP429_RS15050 (3092153) | 3092153..3092350 | - | 198 | WP_000772027.1 | DUF957 domain-containing protein | - |
| NP429_RS15055 (3092370) | 3092370..3092858 | - | 489 | WP_001546173.1 | DUF5983 family protein | - |
| NP429_RS15060 (3092855) | 3092855..3093232 | - | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| NP429_RS15065 (3093321) | 3093321..3093689 | - | 369 | WP_001546171.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NP429_RS15070 (3093739) | 3093739..3094383 | - | 645 | WP_000094915.1 | hypothetical protein | - |
| NP429_RS15075 (3094402) | 3094402..3094623 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| NP429_RS15080 (3094686) | 3094686..3095162 | - | 477 | WP_001537421.1 | RadC family protein | - |
| NP429_RS15085 (3095178) | 3095178..3095651 | - | 474 | WP_000855076.1 | antirestriction protein | - |
| NP429_RS15090 (3095914) | 3095914..3096735 | - | 822 | WP_001234710.1 | DUF932 domain-containing protein | - |
| NP429_RS15095 (3096914) | 3096914..3097003 | - | 90 | WP_230607454.1 | DUF905 family protein | - |
| NP429_RS15100 (3097146) | 3097146..3097601 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T252999 WP_000854690.1 NZ_CP101925:c3093232-3092855 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13745.37 Da Isoelectric Point: 4.6220
>AT252999 WP_001546171.1 NZ_CP101925:c3093689-3093321 [Escherichia coli]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|