Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 830342..831176 Replicon chromosome
Accession NZ_CP101925
Organism Escherichia coli strain Seattle 1946

Toxin (Protein)


Gene name yeeV Uniprot ID A0A0H2VDB0
Locus tag NP429_RS04045 Protein ID WP_000854688.1
Coordinates 830342..830719 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A0H2VAY1
Locus tag NP429_RS04050 Protein ID WP_001285596.1
Coordinates 830796..831176 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP429_RS04015 (825890) 825890..826824 - 935 Protein_789 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
NP429_RS04020 (826817) 826817..827212 - 396 WP_000208383.1 DUF6088 family protein -
NP429_RS04025 (827281) 827281..828126 - 846 WP_001280441.1 DUF4942 domain-containing protein -
NP429_RS04030 (828410) 828410..829429 - 1020 WP_000875213.1 IS110 family transposase -
NP429_RS04035 (829643) 829643..829840 - 198 WP_000839260.1 DUF957 domain-containing protein -
NP429_RS04040 (829857) 829857..830345 - 489 WP_000761701.1 DUF5983 family protein -
NP429_RS04045 (830342) 830342..830719 - 378 WP_000854688.1 TA system toxin CbtA family protein Toxin
NP429_RS04050 (830796) 830796..831176 - 381 WP_001285596.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NP429_RS04055 (831226) 831226..831870 - 645 WP_000094917.1 hypothetical protein -
NP429_RS04060 (831889) 831889..832110 - 222 WP_000692329.1 DUF987 domain-containing protein -
NP429_RS04065 (832173) 832173..832649 - 477 WP_001186726.1 RadC family protein -
NP429_RS04070 (832665) 832665..833150 - 486 WP_000849564.1 antirestriction protein -
NP429_RS04075 (833205) 833205..834023 - 819 WP_001234616.1 DUF932 domain-containing protein -
NP429_RS04080 (834124) 834124..834357 - 234 WP_001119727.1 DUF905 family protein -
NP429_RS04085 (834436) 834436..834891 - 456 WP_000581502.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsM / kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF 807292..833150 25858
- flank IS/Tn - - 828410..829429 1019


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14014.01 Da        Isoelectric Point: 8.5221

>T252987 WP_000854688.1 NZ_CP101925:c830719-830342 [Escherichia coli]
MKTLPDTHVRAASRCPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13897.70 Da        Isoelectric Point: 4.7959

>AT252987 WP_001285596.1 NZ_CP101925:c831176-830796 [Escherichia coli]
MSDTLPGTTLPDDNKDLPWWGLPCAVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H2VDB0

Antitoxin

Source ID Structure
AlphaFold DB A0A0H2VAY1

References