Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yeeU/CbtA-CbeA |
| Location | 46924..47715 | Replicon | chromosome |
| Accession | NZ_CP101925 | ||
| Organism | Escherichia coli strain Seattle 1946 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | NP429_RS00235 | Protein ID | WP_000691791.1 |
| Coordinates | 46924..47349 (-) | Length | 142 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A3L1KVZ6 |
| Locus tag | NP429_RS00240 | Protein ID | WP_000939437.1 |
| Coordinates | 47380..47715 (-) | Length | 112 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP429_RS00210 (42590) | 42590..43087 | - | 498 | WP_000509808.1 | hypothetical protein | - |
| NP429_RS00215 (43769) | 43769..44155 | - | 387 | WP_001270938.1 | DUF2441 domain-containing protein | - |
| NP429_RS00220 (44778) | 44778..45509 | - | 732 | WP_001216639.1 | retron system putative HNH endonuclease | - |
| NP429_RS00225 (45506) | 45506..45727 | - | 222 | WP_125112077.1 | hypothetical protein | - |
| NP429_RS00230 (45712) | 45712..46903 | - | 1192 | Protein_45 | AAA family ATPase | - |
| NP429_RS00235 (46924) | 46924..47349 | - | 426 | WP_000691791.1 | TA system toxin CbtA family protein | Toxin |
| NP429_RS00240 (47380) | 47380..47715 | - | 336 | WP_000939437.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NP429_RS00245 (47715) | 47715..48188 | - | 474 | WP_001292742.1 | DNA repair protein RadC | - |
| NP429_RS00250 (48218) | 48218..49032 | - | 815 | Protein_49 | DUF945 domain-containing protein | - |
| NP429_RS00255 (49268) | 49268..50221 | - | 954 | WP_000290406.1 | hypothetical protein | - |
| NP429_RS00260 (50814) | 50814..51428 | + | 615 | WP_000772910.1 | inovirus Gp2 family protein | - |
| NP429_RS00265 (51546) | 51546..51764 | + | 219 | WP_000070772.1 | AlpA family phage regulatory protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 44778..68709 | 23931 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 142 a.a. Molecular weight: 16490.11 Da Isoelectric Point: 10.2376
>T252985 WP_000691791.1 NZ_CP101925:c47349-46924 [Escherichia coli]
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVNAVNFLVEKYELVRIDRKGF
SWQEQTPYLRAVDILRARQATGLRIQCKNTNIISRMADSRHDKRLYQRTFKACKRCYYTKT
MKIIPATTLRATTSYLSPVVVWQTLLARLLEQHYGLNLNDTPFNNEKVIQEHIDAGITLVNAVNFLVEKYELVRIDRKGF
SWQEQTPYLRAVDILRARQATGLRIQCKNTNIISRMADSRHDKRLYQRTFKACKRCYYTKT
Download Length: 426 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|