Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ataT-KacA/DUF1778(antitoxin) |
| Location | 36819..37617 | Replicon | plasmid pEcFELIX526.1 |
| Accession | NZ_CP101923 | ||
| Organism | Escherichia coli strain JCC-EE 7 | ||
Toxin (Protein)
| Gene name | ataT | Uniprot ID | A0A0K4UCL9 |
| Locus tag | NP442_RS22855 | Protein ID | WP_024173399.1 |
| Coordinates | 37096..37617 (+) | Length | 174 a.a. |
Antitoxin (Protein)
| Gene name | KacA | Uniprot ID | A0A0V9R6Q7 |
| Locus tag | NP442_RS22850 | Protein ID | WP_001351987.1 |
| Coordinates | 36819..37088 (+) | Length | 90 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP442_RS22825 (NP442_22820) | 32359..33699 | - | 1341 | WP_000137333.1 | DnaB-like helicase C-terminal domain-containing protein | - |
| NP442_RS22830 (NP442_22825) | 33743..34483 | - | 741 | WP_021520120.1 | hypothetical protein | - |
| NP442_RS22835 (NP442_22830) | 34673..35428 | - | 756 | WP_085674543.1 | DUF2971 domain-containing protein | - |
| NP442_RS22840 (NP442_22835) | 35473..35826 | - | 354 | WP_164715282.1 | hypothetical protein | - |
| NP442_RS22845 (NP442_22840) | 35832..36500 | - | 669 | WP_000161228.1 | division plane positioning ATPase MipZ | - |
| NP442_RS22850 (NP442_22845) | 36819..37088 | + | 270 | WP_001351987.1 | DUF1778 domain-containing protein | Antitoxin |
| NP442_RS22855 (NP442_22850) | 37096..37617 | + | 522 | WP_024173399.1 | GNAT family N-acetyltransferase | Toxin |
| NP442_RS22860 (NP442_22855) | 37785..38036 | - | 252 | WP_001404395.1 | hypothetical protein | - |
| NP442_RS22865 (NP442_22860) | 38038..38730 | - | 693 | WP_000856757.1 | hypothetical protein | - |
| NP442_RS22870 (NP442_22865) | 38744..39067 | - | 324 | WP_000064175.1 | hypothetical protein | - |
| NP442_RS22875 (NP442_22870) | 39390..39956 | - | 567 | WP_226438823.1 | hypothetical protein | - |
| NP442_RS22880 (NP442_22875) | 39998..40252 | - | 255 | WP_000120169.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaCTX-M-15 | - | 1..111928 | 111928 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 174 a.a. Molecular weight: 19475.31 Da Isoelectric Point: 8.6344
>T252984 WP_024173399.1 NZ_CP101923:37096-37617 [Escherichia coli]
VDNIKIEIFSGEKDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEGRPKVLGYYTLSGSCFEKESLPSRSQQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLDFIQLVGNNERSL
FYPTKSIEKLFEE
VDNIKIEIFSGEKDYDLNGFDCGEESLNAFLTNHLKRQHEGKILRAYVLCTKEGRPKVLGYYTLSGSCFEKESLPSRSQQ
KKVPYRNVPSVTLGRLALDKSLQGQGFGSMLVTHAMRVVYNASLAVGIHGLFVEALNDKAKAFYKSLDFIQLVGNNERSL
FYPTKSIEKLFEE
Download Length: 522 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0K4UCL9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0V9R6Q7 |