Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3625281..3626068 Replicon chromosome
Accession NZ_CP101922
Organism Escherichia coli strain JCC-EE 7

Toxin (Protein)


Gene name yeeV Uniprot ID -
Locus tag NP442_RS17880 Protein ID WP_023280984.1
Coordinates 3625691..3626068 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2H9G3E7
Locus tag NP442_RS17875 Protein ID WP_000066236.1
Coordinates 3625281..3625640 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP442_RS17830 (3620520) 3620520..3620972 + 453 WP_001020418.1 hypothetical protein -
NP442_RS17835 (3620969) 3620969..3621421 + 453 WP_004011054.1 hypothetical protein -
NP442_RS17840 (3621484) 3621484..3622026 + 543 WP_097496558.1 DUF4339 domain-containing protein -
NP442_RS17845 (3622086) 3622086..3622538 + 453 WP_001061894.1 IrmA family protein -
NP442_RS17850 (3622615) 3622615..3622848 + 234 WP_001114682.1 DUF905 domain-containing protein -
NP442_RS17855 (3622968) 3622968..3623786 + 819 WP_001234406.1 DUF932 domain-containing protein -
NP442_RS17860 (3624054) 3624054..3624524 + 471 WP_000131762.1 antirestriction protein -
NP442_RS17865 (3624536) 3624536..3625015 + 480 WP_000437750.1 DNA repair protein RadC -
NP442_RS17870 (3625036) 3625036..3625257 + 222 WP_000691981.1 DUF987 domain-containing protein -
NP442_RS17875 (3625281) 3625281..3625640 + 360 WP_000066236.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
NP442_RS17880 (3625691) 3625691..3626068 + 378 WP_023280984.1 TA system toxin CbtA family protein Toxin
NP442_RS17885 (3626065) 3626065..3626556 + 492 WP_097496559.1 DUF5983 family protein -
NP442_RS17890 (3626588) 3626588..3626791 + 204 WP_000413747.1 DUF957 domain-containing protein -
NP442_RS17895 (3626872) 3626872..3627716 + 845 Protein_3500 DUF4942 domain-containing protein -
NP442_RS17905 (3628058) 3628058..3628789 - 732 WP_001340895.1 DNA polymerase III subunit epsilon -
NP442_RS17910 (3628854) 3628854..3629321 + 468 WP_000917883.1 ribonuclease HI -
NP442_RS17915 (3629318) 3629318..3630040 - 723 WP_001326702.1 class I SAM-dependent methyltransferase -
NP442_RS17920 (3630074) 3630074..3630829 + 756 WP_001052713.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14204.95 Da        Isoelectric Point: 7.4733

>T252982 WP_023280984.1 NZ_CP101922:3625691-3626068 [Escherichia coli]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRHTSIDILRARKATGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13127.02 Da        Isoelectric Point: 7.0261

>AT252982 WP_000066236.1 NZ_CP101922:3625281-3625640 [Escherichia coli]
MSNKIPTVNHDITEPWWGLKRSITPCFGARLVQSGNCLHYLADRASITGQFSDGDLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A2H9G3E7

References