Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3369544..3370162 | Replicon | chromosome |
Accession | NZ_CP101922 | ||
Organism | Escherichia coli strain JCC-EE 7 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | NP442_RS16490 | Protein ID | WP_001291435.1 |
Coordinates | 3369944..3370162 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | NP442_RS16485 | Protein ID | WP_000344800.1 |
Coordinates | 3369544..3369918 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP442_RS16475 (3364633) | 3364633..3365826 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NP442_RS16480 (3365849) | 3365849..3368998 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
NP442_RS16485 (3369544) | 3369544..3369918 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
NP442_RS16490 (3369944) | 3369944..3370162 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
NP442_RS16495 (3370334) | 3370334..3370885 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
NP442_RS16500 (3371001) | 3371001..3371471 | + | 471 | WP_000136192.1 | YlaC family protein | - |
NP442_RS16505 (3371635) | 3371635..3373185 | + | 1551 | WP_001727568.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
NP442_RS16510 (3373227) | 3373227..3373580 | - | 354 | WP_097496338.1 | DUF1428 family protein | - |
NP442_RS16520 (3373959) | 3373959..3374270 | + | 312 | WP_000409911.1 | MGMT family protein | - |
NP442_RS16525 (3374301) | 3374301..3374873 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T252979 WP_001291435.1 NZ_CP101922:3369944-3370162 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT252979 WP_000344800.1 NZ_CP101922:3369544-3369918 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |