Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
Location | 2374106..2374744 | Replicon | chromosome |
Accession | NZ_CP101922 | ||
Organism | Escherichia coli strain JCC-EE 7 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | S1F9G9 |
Locus tag | NP442_RS11515 | Protein ID | WP_000813794.1 |
Coordinates | 2374568..2374744 (-) | Length | 59 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NP442_RS11510 | Protein ID | WP_001270286.1 |
Coordinates | 2374106..2374522 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP442_RS11490 (2369258) | 2369258..2370199 | - | 942 | WP_001251313.1 | ABC transporter permease | - |
NP442_RS11495 (2370200) | 2370200..2371213 | - | 1014 | WP_000220399.1 | ABC transporter ATP-binding protein | - |
NP442_RS11500 (2371231) | 2371231..2372376 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
NP442_RS11505 (2372621) | 2372621..2374027 | - | 1407 | WP_001735217.1 | PLP-dependent aminotransferase family protein | - |
NP442_RS11510 (2374106) | 2374106..2374522 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
NP442_RS11515 (2374568) | 2374568..2374744 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
NP442_RS11520 (2374966) | 2374966..2375196 | + | 231 | WP_000494244.1 | YncJ family protein | - |
NP442_RS11525 (2375288) | 2375288..2377249 | - | 1962 | WP_098717239.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
NP442_RS11530 (2377322) | 2377322..2377858 | - | 537 | WP_000429133.1 | DNA-binding transcriptional regulator SutR | - |
NP442_RS11535 (2377950) | 2377950..2379125 | + | 1176 | WP_252356393.1 | BenE family transporter YdcO | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T252978 WP_000813794.1 NZ_CP101922:c2374744-2374568 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT252978 WP_001270286.1 NZ_CP101922:c2374522-2374106 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|