Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 866447..867101 | Replicon | chromosome |
| Accession | NZ_CP101922 | ||
| Organism | Escherichia coli strain JCC-EE 7 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1PAM6 |
| Locus tag | NP442_RS04245 | Protein ID | WP_000244781.1 |
| Coordinates | 866694..867101 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | S1PPB1 |
| Locus tag | NP442_RS04240 | Protein ID | WP_000354046.1 |
| Coordinates | 866447..866713 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP442_RS04220 (862535) | 862535..863968 | - | 1434 | WP_001394742.1 | 6-phospho-beta-glucosidase BglA | - |
| NP442_RS04225 (864013) | 864013..864324 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
| NP442_RS04230 (864488) | 864488..865147 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
| NP442_RS04235 (865224) | 865224..866204 | - | 981 | WP_000886087.1 | tRNA-modifying protein YgfZ | - |
| NP442_RS04240 (866447) | 866447..866713 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
| NP442_RS04245 (866694) | 866694..867101 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
| NP442_RS04250 (867141) | 867141..867662 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| NP442_RS04255 (867774) | 867774..868670 | + | 897 | WP_000806650.1 | site-specific tyrosine recombinase XerD | - |
| NP442_RS04260 (868695) | 868695..869405 | + | 711 | WP_000715222.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NP442_RS04265 (869411) | 869411..871144 | + | 1734 | WP_000813233.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T252970 WP_000244781.1 NZ_CP101922:866694-867101 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|