Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 788954..789786 | Replicon | chromosome |
| Accession | NZ_CP101922 | ||
| Organism | Escherichia coli strain JCC-EE 7 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A7ZVJ9 |
| Locus tag | NP442_RS03840 | Protein ID | WP_000854765.1 |
| Coordinates | 788954..789328 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | NP442_RS03845 | Protein ID | WP_001295723.1 |
| Coordinates | 789418..789786 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP442_RS03820 (786746) | 786746..787966 | + | 1221 | WP_001735713.1 | capsular biosynthesis protein | - |
| NP442_RS03825 (787992) | 787992..788222 | - | 231 | Protein_751 | hypothetical protein | - |
| NP442_RS03830 (788328) | 788328..788504 | - | 177 | WP_000839288.1 | DUF957 domain-containing protein | - |
| NP442_RS03835 (788521) | 788521..788957 | - | 437 | Protein_753 | DUF5983 family protein | - |
| NP442_RS03840 (788954) | 788954..789328 | - | 375 | WP_000854765.1 | TA system toxin CbtA family protein | Toxin |
| NP442_RS03845 (789418) | 789418..789786 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NP442_RS03850 (789949) | 789949..790170 | - | 222 | WP_001735710.1 | DUF987 domain-containing protein | - |
| NP442_RS03855 (790239) | 790239..790715 | - | 477 | WP_001186725.1 | RadC family protein | - |
| NP442_RS03860 (790731) | 790731..791216 | - | 486 | WP_001735709.1 | antirestriction protein | - |
| NP442_RS03865 (791271) | 791271..792089 | - | 819 | WP_074481115.1 | DUF932 domain-containing protein | - |
| NP442_RS03870 (792207) | 792207..792402 | - | 196 | Protein_760 | DUF905 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13970.98 Da Isoelectric Point: 7.2909
>T252969 WP_000854765.1 NZ_CP101922:c789328-788954 [Escherichia coli]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYSLTLNDTPFVDERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGASSQLINSIDILRARRATGLMTRHNYRTVNNITLGKYPEAK
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT252969 WP_001295723.1 NZ_CP101922:c789786-789418 [Escherichia coli]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|