Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 4188171..4188766 | Replicon | chromosome |
| Accession | NZ_CP101921 | ||
| Organism | Escherichia coli strain QA-1986 83 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | U9Y4M4 |
| Locus tag | NP438_RS20245 | Protein ID | WP_000239579.1 |
| Coordinates | 4188171..4188521 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | A0A2J1DIF8 |
| Locus tag | NP438_RS20250 | Protein ID | WP_001223209.1 |
| Coordinates | 4188515..4188766 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP438_RS20225 (4183617) | 4183617..4184639 | - | 1023 | WP_024251350.1 | ABC transporter permease | - |
| NP438_RS20230 (4184653) | 4184653..4186155 | - | 1503 | WP_000205810.1 | sugar ABC transporter ATP-binding protein | - |
| NP438_RS20235 (4186295) | 4186295..4187251 | - | 957 | WP_000265933.1 | galactofuranose ABC transporter substrate-binding protein YtfQ | - |
| NP438_RS20240 (4187561) | 4187561..4188091 | + | 531 | WP_000055075.1 | inorganic diphosphatase | - |
| NP438_RS20245 (4188171) | 4188171..4188521 | - | 351 | WP_000239579.1 | endoribonuclease toxin ChpB | Toxin |
| NP438_RS20250 (4188515) | 4188515..4188766 | - | 252 | WP_001223209.1 | type II toxin-antitoxin system antitoxin ChpS | Antitoxin |
| NP438_RS20255 (4188978) | 4188978..4189319 | - | 342 | WP_001219160.1 | gamma-glutamylcyclotransferase | - |
| NP438_RS20260 (4189322) | 4189322..4193101 | - | 3780 | WP_000060896.1 | autotransporter assembly complex protein TamB | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12511.45 Da Isoelectric Point: 5.6219
>T252963 WP_000239579.1 NZ_CP101921:c4188521-4188171 [Escherichia coli]
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
MVKKSEFERGDIVLVGFDPASGHEQQGAGRPALVLSVQAFNQLGMTLVAPITQGGNFARYAGFSVPLHCEEGDVHGVVLV
NQVRMMDLRARLAKRIGLAADEVVEEALLRLQAVVE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E0Y8A8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J1DIF8 |