Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1345774..1346399 | Replicon | chromosome |
Accession | NZ_CP101921 | ||
Organism | Escherichia coli strain QA-1986 83 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | A0A2J1DF47 |
Locus tag | NP438_RS06555 | Protein ID | WP_000911331.1 |
Coordinates | 1346001..1346399 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NP438_RS06550 | Protein ID | WP_000450524.1 |
Coordinates | 1345774..1346001 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP438_RS06525 (1341577) | 1341577..1342047 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
NP438_RS06530 (1342047) | 1342047..1342619 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NP438_RS06535 (1342765) | 1342765..1343643 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NP438_RS06540 (1343660) | 1343660..1344694 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NP438_RS06545 (1344907) | 1344907..1345620 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NP438_RS06550 (1345774) | 1345774..1346001 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NP438_RS06555 (1346001) | 1346001..1346399 | + | 399 | WP_000911331.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NP438_RS06560 (1346546) | 1346546..1347409 | + | 864 | WP_001267507.1 | neutral zinc metallopeptidase | - |
NP438_RS06565 (1347424) | 1347424..1349439 | + | 2016 | WP_001543081.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NP438_RS06570 (1349513) | 1349513..1350211 | + | 699 | WP_000679812.1 | esterase | - |
NP438_RS06575 (1350321) | 1350321..1350521 | - | 201 | WP_089631931.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14862.19 Da Isoelectric Point: 9.2216
>T252948 WP_000911331.1 NZ_CP101921:1346001-1346399 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLVELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLVELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J1DF47 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CM33 |