Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1003205..1003788 | Replicon | chromosome |
Accession | NZ_CP101921 | ||
Organism | Escherichia coli strain QA-1986 83 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | U9XFN8 |
Locus tag | NP438_RS04840 | Protein ID | WP_000254745.1 |
Coordinates | 1003453..1003788 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A2J1DJJ7 |
Locus tag | NP438_RS04835 | Protein ID | WP_000581939.1 |
Coordinates | 1003205..1003453 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP438_RS04825 (999544) | 999544..1000845 | + | 1302 | WP_000046790.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
NP438_RS04830 (1000893) | 1000893..1003127 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
NP438_RS04835 (1003205) | 1003205..1003453 | + | 249 | WP_000581939.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
NP438_RS04840 (1003453) | 1003453..1003788 | + | 336 | WP_000254745.1 | endoribonuclease MazF | Toxin |
NP438_RS04845 (1003859) | 1003859..1004650 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
NP438_RS04850 (1004878) | 1004878..1006515 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
NP438_RS04855 (1006603) | 1006603..1007901 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12158.08 Da Isoelectric Point: 8.4777
>T252947 WP_000254745.1 NZ_CP101921:1003453-1003788 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPYTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E0XYM3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2J1DJJ7 |