Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3708066..3708684 | Replicon | chromosome |
| Accession | NZ_CP101920 | ||
| Organism | Escherichia coli strain QA-1986 630 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | NP447_RS18110 | Protein ID | WP_001291435.1 |
| Coordinates | 3708466..3708684 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | E9TLB8 |
| Locus tag | NP447_RS18105 | Protein ID | WP_000344794.1 |
| Coordinates | 3708066..3708440 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP447_RS18095 (3703155) | 3703155..3704348 | + | 1194 | WP_001295324.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| NP447_RS18100 (3704371) | 3704371..3707520 | + | 3150 | WP_001132469.1 | efflux RND transporter permease AcrB | - |
| NP447_RS18105 (3708066) | 3708066..3708440 | + | 375 | WP_000344794.1 | Hha toxicity modulator TomB | Antitoxin |
| NP447_RS18110 (3708466) | 3708466..3708684 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| NP447_RS18115 (3708855) | 3708855..3709406 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
| NP447_RS18120 (3709522) | 3709522..3709992 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| NP447_RS18125 (3710156) | 3710156..3711706 | + | 1551 | WP_114747478.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| NP447_RS18130 (3711748) | 3711748..3712101 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
| NP447_RS18140 (3712480) | 3712480..3712791 | + | 312 | WP_000409911.1 | MGMT family protein | - |
| NP447_RS18145 (3712822) | 3712822..3713394 | - | 573 | WP_000779826.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T252940 WP_001291435.1 NZ_CP101920:3708466-3708684 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14527.36 Da Isoelectric Point: 4.9284
>AT252940 WP_000344794.1 NZ_CP101920:3708066-3708440 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGRVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGRVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|