Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2587113..2587751 | Replicon | chromosome |
| Accession | NZ_CP101920 | ||
| Organism | Escherichia coli strain QA-1986 630 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | S1F9G9 |
| Locus tag | NP447_RS12280 | Protein ID | WP_000813794.1 |
| Coordinates | 2587575..2587751 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NP447_RS12275 | Protein ID | WP_001270286.1 |
| Coordinates | 2587113..2587529 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP447_RS12255 (2582265) | 2582265..2583206 | - | 942 | WP_001251315.1 | ABC transporter permease | - |
| NP447_RS12260 (2583207) | 2583207..2584220 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NP447_RS12265 (2584238) | 2584238..2585383 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| NP447_RS12270 (2585628) | 2585628..2587034 | - | 1407 | WP_000760663.1 | PLP-dependent aminotransferase family protein | - |
| NP447_RS12275 (2587113) | 2587113..2587529 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NP447_RS12280 (2587575) | 2587575..2587751 | - | 177 | WP_000813794.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NP447_RS12285 (2587973) | 2587973..2588203 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NP447_RS12290 (2588295) | 2588295..2590256 | - | 1962 | WP_001442195.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NP447_RS12295 (2590329) | 2590329..2590865 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NP447_RS12300 (2590957) | 2590957..2592132 | + | 1176 | WP_001583501.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2592172..2593320 | 1148 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6749.83 Da Isoelectric Point: 11.2298
>T252938 WP_000813794.1 NZ_CP101920:c2587751-2587575 [Escherichia coli]
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANGSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT252938 WP_001270286.1 NZ_CP101920:c2587529-2587113 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|