Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 1473786..1474411 | Replicon | chromosome |
Accession | NZ_CP101920 | ||
Organism | Escherichia coli strain QA-1986 630 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NP447_RS07025 | Protein ID | WP_000911330.1 |
Coordinates | 1474013..1474411 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U9XQV3 |
Locus tag | NP447_RS07020 | Protein ID | WP_000450524.1 |
Coordinates | 1473786..1474013 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP447_RS06995 (1469589) | 1469589..1470059 | - | 471 | WP_001068682.1 | thioredoxin-dependent thiol peroxidase | - |
NP447_RS07000 (1470059) | 1470059..1470631 | - | 573 | WP_000176187.1 | glycine cleavage system transcriptional repressor | - |
NP447_RS07005 (1470777) | 1470777..1471655 | + | 879 | WP_001295469.1 | 4-hydroxy-tetrahydrodipicolinate synthase | - |
NP447_RS07010 (1471672) | 1471672..1472706 | + | 1035 | WP_001297320.1 | outer membrane protein assembly factor BamC | - |
NP447_RS07015 (1472919) | 1472919..1473632 | + | 714 | WP_001295467.1 | phosphoribosylaminoimidazolesuccinocarboxamide synthase | - |
NP447_RS07020 (1473786) | 1473786..1474013 | + | 228 | WP_000450524.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
NP447_RS07025 (1474013) | 1474013..1474411 | + | 399 | WP_000911330.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NP447_RS07030 (1474558) | 1474558..1475421 | + | 864 | WP_001267498.1 | neutral zinc metallopeptidase | - |
NP447_RS07035 (1475436) | 1475436..1477451 | + | 2016 | WP_001402395.1 | tRNA cytosine(34) acetyltransferase TmcA | - |
NP447_RS07040 (1477525) | 1477525..1478223 | + | 699 | WP_000679812.1 | esterase | - |
NP447_RS07045 (1478333) | 1478333..1478533 | - | 201 | WP_000383836.1 | YpfN family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14894.25 Da Isoelectric Point: 9.2216
>T252931 WP_000911330.1 NZ_CP101920:1474013-1474411 [Escherichia coli]
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
MLKFMLDTNICIFTIKNKPVHVRERFNLNSGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRLVVLDYDSAAATHT
GQIRAELARQGRPVGPFDQMIAGHARSRGLIVVTNNTREFERVAGIRLEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|