Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1000141..1000795 | Replicon | chromosome |
Accession | NZ_CP101920 | ||
Organism | Escherichia coli strain QA-1986 630 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | S1PAM6 |
Locus tag | NP447_RS04835 | Protein ID | WP_000244781.1 |
Coordinates | 1000388..1000795 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | S1PPB1 |
Locus tag | NP447_RS04830 | Protein ID | WP_000354046.1 |
Coordinates | 1000141..1000407 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP447_RS04805 (995310) | 995310..996053 | + | 744 | WP_000951961.1 | SDR family oxidoreductase | - |
NP447_RS04810 (996110) | 996110..997543 | - | 1434 | WP_001344773.1 | 6-phospho-beta-glucosidase BglA | - |
NP447_RS04815 (997588) | 997588..997899 | + | 312 | WP_001182954.1 | N(4)-acetylcytidine aminohydrolase | - |
NP447_RS04820 (998063) | 998063..998722 | + | 660 | WP_000250274.1 | hemolysin III family protein | - |
NP447_RS04825 (998918) | 998918..999898 | - | 981 | WP_000886095.1 | tRNA-modifying protein YgfZ | - |
NP447_RS04830 (1000141) | 1000141..1000407 | + | 267 | WP_000354046.1 | FAD assembly factor SdhE | Antitoxin |
NP447_RS04835 (1000388) | 1000388..1000795 | + | 408 | WP_000244781.1 | protein YgfX | Toxin |
NP447_RS04840 (1000835) | 1000835..1001356 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
NP447_RS04845 (1001468) | 1001468..1002364 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
NP447_RS04850 (1002389) | 1002389..1003099 | + | 711 | WP_000715208.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NP447_RS04855 (1003105) | 1003105..1004838 | + | 1734 | WP_000813218.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16061.99 Da Isoelectric Point: 11.5202
>T252929 WP_000244781.1 NZ_CP101920:1000388-1000795 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|