Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 796573..797405 | Replicon | chromosome |
| Accession | NZ_CP101920 | ||
| Organism | Escherichia coli strain QA-1986 630 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PD64 |
| Locus tag | NP447_RS03840 | Protein ID | WP_000854753.1 |
| Coordinates | 796573..796947 (-) | Length | 125 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | E3PJ72 |
| Locus tag | NP447_RS03845 | Protein ID | WP_001278232.1 |
| Coordinates | 797037..797405 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP447_RS03810 (791784) | 791784..792962 | + | 1179 | WP_000094971.1 | type II secretion system protein GspL | - |
| NP447_RS03815 (792964) | 792964..793500 | + | 537 | WP_023155911.1 | GspM family type II secretion system protein YghD | - |
| NP447_RS03820 (793781) | 793781..794350 | - | 570 | WP_001290247.1 | DUF4942 domain-containing protein | - |
| NP447_RS03825 (794634) | 794634..795653 | - | 1020 | WP_000875212.1 | IS110 family transposase | - |
| NP447_RS03830 (795879) | 795879..796076 | - | 198 | WP_000839281.1 | DUF957 domain-containing protein | - |
| NP447_RS03835 (796088) | 796088..796576 | - | 489 | WP_000777541.1 | DUF5983 family protein | - |
| NP447_RS03840 (796573) | 796573..796947 | - | 375 | WP_000854753.1 | TA system toxin CbtA family protein | Toxin |
| NP447_RS03845 (797037) | 797037..797405 | - | 369 | WP_001278232.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| NP447_RS03850 (797568) | 797568..797789 | - | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| NP447_RS03855 (797852) | 797852..798328 | - | 477 | WP_001186727.1 | RadC family protein | - |
| NP447_RS03860 (798344) | 798344..798829 | - | 486 | WP_044860884.1 | antirestriction protein | - |
| NP447_RS03865 (798884) | 798884..799702 | - | 819 | WP_086353160.1 | DUF932 domain-containing protein | - |
| NP447_RS03870 (799802) | 799802..800035 | - | 234 | WP_001119724.1 | DUF905 family protein | - |
| NP447_RS03875 (800114) | 800114..800569 | - | 456 | WP_000581504.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 794634..795653 | 1019 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 14005.00 Da Isoelectric Point: 8.2905
>T252928 WP_000854753.1 NZ_CP101920:c796947-796573 [Escherichia coli]
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
MKTLPDTHVREASSCPSPVTIWQTLLSRLLGQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
STCPRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKHPEKR
Download Length: 375 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13491.37 Da Isoelectric Point: 6.6290
>AT252928 WP_001278232.1 NZ_CP101920:c797405-797037 [Escherichia coli]
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
VSDALSGTMLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLGSGGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LVU0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | E3PJ72 |