Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 46524..47046 Replicon plasmid pEcFELIX705.1
Accession NZ_CP101916
Organism Escherichia coli strain Evo1

Toxin (Protein)


Gene name relE Uniprot ID G3CAN5
Locus tag NP443_RS22905 Protein ID WP_000220560.1
Coordinates 46765..47046 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID G3CAG1
Locus tag NP443_RS22900 Protein ID WP_000121743.1
Coordinates 46524..46775 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP443_RS22870 (NP443_22840) 41887..42117 + 231 WP_000051064.1 plasmid partition protein ParG -
NP443_RS22875 (NP443_22845) 42133..42426 + 294 WP_015060510.1 hypothetical protein -
NP443_RS22880 (NP443_22850) 42428..43396 + 969 WP_077249520.1 IS5-like element IS903B family transposase -
NP443_RS22885 (NP443_22855) 43456..43809 - 354 WP_000876434.1 DNA distortion polypeptide 3 -
NP443_RS22890 (NP443_22860) 43946..44392 - 447 WP_001074386.1 hypothetical protein -
NP443_RS22895 (NP443_22865) 44432..45268 - 837 WP_001050931.1 RepB family plasmid replication initiator protein -
NP443_RS22900 (NP443_22870) 46524..46775 + 252 WP_000121743.1 plasmid stabilization protein Antitoxin
NP443_RS22905 (NP443_22875) 46765..47046 + 282 WP_000220560.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NP443_RS22910 (NP443_22880) 47192..47515 + 324 WP_001181903.1 hypothetical protein -
NP443_RS22915 (NP443_22885) 47560..47805 + 246 WP_000356546.1 hypothetical protein -
NP443_RS22920 (NP443_22890) 47795..48010 + 216 WP_001180116.1 hypothetical protein -
NP443_RS22925 (NP443_22895) 48103..48432 + 330 WP_000866648.1 hypothetical protein -
NP443_RS22930 (NP443_22900) 48719..48868 + 150 WP_000003880.1 hypothetical protein -
NP443_RS22935 (NP443_22905) 48881..49153 + 273 WP_000160399.1 hypothetical protein -
NP443_RS22940 (NP443_22910) 49480..50025 + 546 WP_038976855.1 DNA distortion polypeptide 1 -
NP443_RS22945 (NP443_22915) 50028..51185 + 1158 WP_000538023.1 DNA distortion polypeptide 2 -
NP443_RS22950 (NP443_22920) 51546..52037 + 492 WP_000872475.1 transcription termination/antitermination NusG family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-176 / aph(3')-Ia / ant(3'')-Ia / sul3 / lnu(F) / aac(3)-IId / tet(A) - 1..129083 129083


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(5-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11005.83 Da        Isoelectric Point: 10.5938

>T252925 WP_000220560.1 NZ_CP101916:46765-47046 [Escherichia coli]
MTYELAFDRRALKEWQKLGHTIREQFKKKLAERLENPRVPAARLHGHADRYKIKLRASGYRLVYQVIDEKVVLLVIAVGR
RESSEVYQIADLR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9194.43 Da        Isoelectric Point: 4.1683

>AT252925 WP_000121743.1 NZ_CP101916:46524-46775 [Escherichia coli]
MSYQILTTTAASITDLKKNPMGTVAEGEGDAVAILNRNEPAFYCVPPKLYAYYRELAEDAELNAVADERMKNPEIVKVNL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB G3CAN5

Antitoxin

Source ID Structure
AlphaFold DB A0A3S5I301

References