Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 18139..18782 | Replicon | plasmid pEcFELIX705.1 |
| Accession | NZ_CP101916 | ||
| Organism | Escherichia coli strain Evo1 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q84A06 |
| Locus tag | NP443_RS22750 | Protein ID | WP_000754566.1 |
| Coordinates | 18139..18555 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q84A07 |
| Locus tag | NP443_RS22755 | Protein ID | WP_001261276.1 |
| Coordinates | 18552..18782 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP443_RS22735 (NP443_22705) | 13811..16708 | - | 2898 | WP_087825204.1 | Tn3-like element Tn5403 family transposase | - |
| NP443_RS22740 (NP443_22710) | 16803..17408 | + | 606 | WP_104209005.1 | recombinase family protein | - |
| NP443_RS22745 (NP443_22715) | 17442..17935 | - | 494 | Protein_18 | IS3-like element ISEc15 family transposase | - |
| NP443_RS22750 (NP443_22720) | 18139..18555 | - | 417 | WP_000754566.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NP443_RS22755 (NP443_22725) | 18552..18782 | - | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NP443_RS22760 (NP443_22730) | 19356..19706 | + | 351 | WP_000493378.1 | hypothetical protein | - |
| NP443_RS22765 (NP443_22735) | 19757..20500 | + | 744 | WP_000129823.1 | hypothetical protein | - |
| NP443_RS22770 (NP443_22740) | 20497..21273 | + | 777 | WP_000015958.1 | site-specific integrase | - |
| NP443_RS22775 (NP443_22745) | 21331..21588 | - | 258 | WP_000764642.1 | hypothetical protein | - |
| NP443_RS22780 (NP443_22750) | 21717..21821 | - | 105 | WP_032409716.1 | hypothetical protein | - |
| NP443_RS22785 (NP443_22755) | 22351..23217 | + | 867 | WP_004118283.1 | replication initiation protein | - |
| NP443_RS22790 (NP443_22760) | 23394..23663 | - | 270 | WP_000339857.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-176 / aph(3')-Ia / ant(3'')-Ia / sul3 / lnu(F) / aac(3)-IId / tet(A) | - | 1..129083 | 129083 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15006.52 Da Isoelectric Point: 9.2957
>T252924 WP_000754566.1 NZ_CP101916:c18555-18139 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K1G3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A387K023 |