Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 18139..18782 Replicon plasmid pEcFELIX705.1
Accession NZ_CP101916
Organism Escherichia coli strain Evo1

Toxin (Protein)


Gene name vagD Uniprot ID Q84A06
Locus tag NP443_RS22750 Protein ID WP_000754566.1
Coordinates 18139..18555 (-) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q84A07
Locus tag NP443_RS22755 Protein ID WP_001261276.1
Coordinates 18552..18782 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP443_RS22735 (NP443_22705) 13811..16708 - 2898 WP_087825204.1 Tn3-like element Tn5403 family transposase -
NP443_RS22740 (NP443_22710) 16803..17408 + 606 WP_104209005.1 recombinase family protein -
NP443_RS22745 (NP443_22715) 17442..17935 - 494 Protein_18 IS3-like element ISEc15 family transposase -
NP443_RS22750 (NP443_22720) 18139..18555 - 417 WP_000754566.1 type II toxin-antitoxin system VapC family toxin Toxin
NP443_RS22755 (NP443_22725) 18552..18782 - 231 WP_001261276.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NP443_RS22760 (NP443_22730) 19356..19706 + 351 WP_000493378.1 hypothetical protein -
NP443_RS22765 (NP443_22735) 19757..20500 + 744 WP_000129823.1 hypothetical protein -
NP443_RS22770 (NP443_22740) 20497..21273 + 777 WP_000015958.1 site-specific integrase -
NP443_RS22775 (NP443_22745) 21331..21588 - 258 WP_000764642.1 hypothetical protein -
NP443_RS22780 (NP443_22750) 21717..21821 - 105 WP_032409716.1 hypothetical protein -
NP443_RS22785 (NP443_22755) 22351..23217 + 867 WP_004118283.1 replication initiation protein -
NP443_RS22790 (NP443_22760) 23394..23663 - 270 WP_000339857.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-176 / aph(3')-Ia / ant(3'')-Ia / sul3 / lnu(F) / aac(3)-IId / tet(A) - 1..129083 129083


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15006.52 Da        Isoelectric Point: 9.2957

>T252924 WP_000754566.1 NZ_CP101916:c18555-18139 [Escherichia coli]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAVLPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAILVTNNVREFARVPGLVLEDWVK

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8721.74 Da        Isoelectric Point: 4.3533

>AT252924 WP_001261276.1 NZ_CP101916:c18782-18552 [Escherichia coli]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRADPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A387K1G3

Antitoxin

Source ID Structure
AlphaFold DB A0A387K023

References