Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 1773..2269 Replicon plasmid pEcFELIX705.1
Accession NZ_CP101916
Organism Escherichia coli strain Evo1

Toxin (Protein)


Gene name parE Uniprot ID -
Locus tag NP443_RS22670 Protein ID WP_250694196.1
Coordinates 2042..2269 (+) Length 76 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A829FT18
Locus tag NP443_RS22665 Protein ID WP_000079938.1
Coordinates 1773..2042 (+) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP443_RS22655 (NP443_22625) 1..858 + 858 WP_000130961.1 incFII family plasmid replication initiator RepA -
NP443_RS22660 (NP443_22630) 1560..1700 + 141 WP_160784086.1 hypothetical protein -
NP443_RS22665 (NP443_22635) 1773..2042 + 270 WP_000079938.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
NP443_RS22670 (NP443_22640) 2042..2269 + 228 WP_250694196.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
NP443_RS22675 (NP443_22645) 2587..2723 + 137 Protein_4 IS5/IS1182 family transposase -
NP443_RS22680 (NP443_22650) 2805..3501 - 697 Protein_5 IS1 family transposase -
NP443_RS22685 (NP443_22655) 3680..4648 - 969 WP_256692679.1 IS5 family transposase -
NP443_RS22690 (NP443_22660) 4689..4982 - 294 WP_256692680.1 biofilm development regulator YmgB/AriR family protein -
NP443_RS22695 (NP443_22665) 5298..5995 + 698 WP_256692681.1 IS1-like element IS1SD family transposase -
NP443_RS22700 (NP443_22670) 6063..6167 - 105 Protein_9 IS3 family transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaTEM-176 / aph(3')-Ia / ant(3'')-Ia / sul3 / lnu(F) / aac(3)-IId / tet(A) - 1..129083 129083


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-73)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 76 a.a.        Molecular weight: 8651.88 Da        Isoelectric Point: 5.6663

>T252923 WP_250694196.1 NZ_CP101916:2042-2269 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMVAIELDERIGYSASSLAGQPYKGRNGRVEGARELVIHPHFVLVYEVDSP

Download         Length: 228 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10251.64 Da        Isoelectric Point: 10.1734

>AT252923 WP_000079938.1 NZ_CP101916:1773-2042 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVAAGRQQLKRGDVLPHDMVESSAAAWRD
EMSRKVADK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A829FT18

References