Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/UPF0150(antitoxin) |
| Location | 2375620..2376258 | Replicon | chromosome |
| Accession | NZ_CP101915 | ||
| Organism | Escherichia coli strain Evo1 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A0A6TXU8 |
| Locus tag | NP443_RS11385 | Protein ID | WP_001447010.1 |
| Coordinates | 2376082..2376258 (-) | Length | 59 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | NP443_RS11380 | Protein ID | WP_001270286.1 |
| Coordinates | 2375620..2376036 (-) | Length | 139 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP443_RS11360 (2370772) | 2370772..2371713 | - | 942 | WP_001251304.1 | ABC transporter permease | - |
| NP443_RS11365 (2371714) | 2371714..2372727 | - | 1014 | WP_000220396.1 | ABC transporter ATP-binding protein | - |
| NP443_RS11370 (2372745) | 2372745..2373890 | - | 1146 | WP_000047424.1 | ABC transporter substrate-binding protein | - |
| NP443_RS11375 (2374135) | 2374135..2375541 | - | 1407 | WP_000760626.1 | PLP-dependent aminotransferase family protein | - |
| NP443_RS11380 (2375620) | 2375620..2376036 | - | 417 | WP_001270286.1 | type II toxin-antitoxin system antitoxin HicB | Antitoxin |
| NP443_RS11385 (2376082) | 2376082..2376258 | - | 177 | WP_001447010.1 | type II toxin-antitoxin system mRNA interferase toxin HicA | Toxin |
| NP443_RS11390 (2376480) | 2376480..2376710 | + | 231 | WP_000494244.1 | YncJ family protein | - |
| NP443_RS11395 (2376802) | 2376802..2378763 | - | 1962 | WP_001303492.1 | 23S rRNA 5-hydroxycytidine C2501 synthase | - |
| NP443_RS11400 (2378836) | 2378836..2379372 | - | 537 | WP_000429155.1 | DNA-binding transcriptional regulator SutR | - |
| NP443_RS11405 (2379464) | 2379464..2380639 | + | 1176 | WP_001236265.1 | BenE family transporter YdcO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6779.86 Da Isoelectric Point: 11.2298
>T252916 WP_001447010.1 NZ_CP101915:c2376258-2376082 [Escherichia coli]
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
VKQSEFRRWLESQGVDVANSSNHLKLRFHGRRSVMPRHPCDEIKEPLRKAILKQLGLS
Download Length: 177 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15246.63 Da Isoelectric Point: 4.7386
>AT252916 WP_001270286.1 NZ_CP101915:c2376036-2375620 [Escherichia coli]
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
MRYPVTLTPAPEGGYMVSFVDIPEALTQGETVAEAMEAAKDALLTAFDFYFEDNELIPLPSPLNSHDHFIEVPLSVASKV
LLLNAFLQSEITQQELARRIGKPKQEITRLFNLHHATKIDAVQLAAKALGKELSLVMV
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|