Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 1118569..1119224 | Replicon | chromosome |
Accession | NZ_CP101914 | ||
Organism | Oceanobacillus jeddahense strain QA-1986 374 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | NP439_RS05610 | Protein ID | WP_040983616.1 |
Coordinates | 1118862..1119224 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NP439_RS05605 | Protein ID | WP_040983614.1 |
Coordinates | 1118569..1118856 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP439_RS05585 (NP439_05585) | 1114074..1114859 | - | 786 | WP_256709128.1 | rhomboid family intramembrane serine protease | - |
NP439_RS05590 (NP439_05590) | 1114988..1115341 | + | 354 | WP_256709129.1 | holo-ACP synthase | - |
NP439_RS05595 (NP439_05595) | 1115427..1116941 | + | 1515 | WP_256709130.1 | NAD(P)H-hydrate dehydratase | - |
NP439_RS05600 (NP439_05600) | 1117007..1118044 | + | 1038 | WP_256709131.1 | DUF4367 domain-containing protein | - |
NP439_RS05605 (NP439_05605) | 1118569..1118856 | + | 288 | WP_040983614.1 | hypothetical protein | Antitoxin |
NP439_RS05610 (NP439_05610) | 1118862..1119224 | + | 363 | WP_040983616.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NP439_RS05615 (NP439_05615) | 1119616..1120329 | + | 714 | WP_256709132.1 | HAD family hydrolase | - |
NP439_RS05620 (NP439_05620) | 1120790..1121659 | + | 870 | WP_256709133.1 | RsbT co-antagonist protein RsbRA | - |
NP439_RS05625 (NP439_05625) | 1121663..1122019 | + | 357 | WP_040983621.1 | STAS domain-containing protein | - |
NP439_RS05630 (NP439_05630) | 1122023..1122424 | + | 402 | WP_040983623.1 | anti-sigma regulatory factor | - |
NP439_RS05635 (NP439_05635) | 1122605..1123618 | + | 1014 | WP_256709134.1 | PP2C family protein-serine/threonine phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13494.56 Da Isoelectric Point: 7.0142
>T252903 WP_040983616.1 NZ_CP101914:1118862-1119224 [Oceanobacillus jeddahense]
VIVQRGEVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDKEMMEKIDQSLEISLGLRDVYSNN
VIVQRGEVYFADLSPVVGSEQGGVRPVLIIQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDKEMMEKIDQSLEISLGLRDVYSNN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|