Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
Location | 1140240..1140895 | Replicon | chromosome |
Accession | NZ_CP101913 | ||
Organism | Oceanobacillus oncorhynchi strain QA-1986 526 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A0A1MUC5 |
Locus tag | NP440_RS05670 | Protein ID | WP_042532419.1 |
Coordinates | 1140533..1140895 (+) | Length | 121 a.a. |
Antitoxin (Protein)
Gene name | pemI | Uniprot ID | - |
Locus tag | NP440_RS05665 | Protein ID | WP_042532417.1 |
Coordinates | 1140240..1140527 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP440_RS05645 (NP440_05645) | 1135798..1136583 | - | 786 | WP_256705800.1 | rhomboid family intramembrane serine protease | - |
NP440_RS05650 (NP440_05650) | 1136715..1137071 | + | 357 | WP_193064389.1 | holo-ACP synthase | - |
NP440_RS05655 (NP440_05655) | 1137155..1138672 | + | 1518 | WP_193064388.1 | NAD(P)H-hydrate dehydratase | - |
NP440_RS05660 (NP440_05660) | 1138736..1139773 | + | 1038 | WP_042532414.1 | outer membrane lipoprotein carrier protein LolA | - |
NP440_RS05665 (NP440_05665) | 1140240..1140527 | + | 288 | WP_042532417.1 | hypothetical protein | Antitoxin |
NP440_RS05670 (NP440_05670) | 1140533..1140895 | + | 363 | WP_042532419.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
NP440_RS05675 (NP440_05675) | 1141394..1142107 | + | 714 | WP_042532423.1 | HAD family hydrolase | - |
NP440_RS05680 (NP440_05680) | 1142720..1143130 | + | 411 | WP_256705801.1 | NADPH-dependent FMN reductase | - |
NP440_RS05685 (NP440_05685) | 1143545..1144414 | + | 870 | WP_042532426.1 | RsbT co-antagonist protein RsbRA | - |
NP440_RS05690 (NP440_05690) | 1144420..1144776 | + | 357 | WP_042532428.1 | STAS domain-containing protein | - |
NP440_RS05695 (NP440_05695) | 1144780..1145181 | + | 402 | WP_042532430.1 | anti-sigma regulatory factor | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13493.58 Da Isoelectric Point: 8.4725
>T252902 WP_042532419.1 NZ_CP101913:1140533-1140895 [Oceanobacillus oncorhynchi]
VIVQRGEVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDKEMMEKINQSLEISLGLRDVYSNN
VIVQRGEVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGFDRNSVILLEQI
RTLDKQRLTDKITKLDKEMMEKINQSLEISLGLRDVYSNN
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|