Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 5537877..5538463 | Replicon | chromosome |
Accession | NZ_CP101912 | ||
Organism | Pseudomonas aeruginosa strain ATCC 27853 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | NP446_RS26200 | Protein ID | WP_003120987.1 |
Coordinates | 5538164..5538463 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NP446_RS26195 | Protein ID | WP_003448662.1 |
Coordinates | 5537877..5538167 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP446_RS26175 (NP446_26175) | 5533028..5533237 | + | 210 | WP_003105733.1 | cold-shock protein | - |
NP446_RS26180 (NP446_26180) | 5533459..5535348 | + | 1890 | WP_016851610.1 | hypothetical protein | - |
NP446_RS26185 (NP446_26185) | 5535345..5537321 | + | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
NP446_RS26190 (NP446_26190) | 5537462..5537806 | + | 345 | WP_016851612.1 | hypothetical protein | - |
NP446_RS26195 (NP446_26195) | 5537877..5538167 | - | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
NP446_RS26200 (NP446_26200) | 5538164..5538463 | - | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP446_RS26205 (NP446_26205) | 5538665..5539789 | + | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
NP446_RS26210 (NP446_26210) | 5539789..5541498 | + | 1710 | WP_012076860.1 | PilN family type IVB pilus formation outer membrane protein | - |
NP446_RS26215 (NP446_26215) | 5541502..5542827 | + | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
NP446_RS26220 (NP446_26220) | 5542817..5543350 | + | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5510898..5613734 | 102836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T252900 WP_003120987.1 NZ_CP101912:c5538463-5538164 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|