Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 5140889..5141497 | Replicon | chromosome |
Accession | NZ_CP101912 | ||
Organism | Pseudomonas aeruginosa strain ATCC 27853 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | A0A1B1XUZ2 |
Locus tag | NP446_RS24350 | Protein ID | WP_003123043.1 |
Coordinates | 5140889..5141236 (-) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | NP446_RS24355 | Protein ID | WP_003114155.1 |
Coordinates | 5141246..5141497 (-) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP446_RS24325 (NP446_24325) | 5137165..5138397 | + | 1233 | WP_016852057.1 | phosphoadenosine phosphosulfate reductase family protein | - |
NP446_RS24330 (NP446_24330) | 5138408..5138584 | + | 177 | WP_016852058.1 | hypothetical protein | - |
NP446_RS24335 (NP446_24335) | 5138581..5138949 | + | 369 | WP_016852059.1 | ASCH domain-containing protein | - |
NP446_RS24340 (NP446_24340) | 5139142..5139345 | + | 204 | WP_003098423.1 | AlpA family phage regulatory protein | - |
NP446_RS24345 (NP446_24345) | 5139352..5140554 | - | 1203 | WP_016852061.1 | integrase family protein | - |
NP446_RS24350 (NP446_24350) | 5140889..5141236 | - | 348 | WP_003123043.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP446_RS24355 (NP446_24355) | 5141246..5141497 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
NP446_RS24360 (NP446_24360) | 5141711..5142694 | - | 984 | WP_016852062.1 | tyrosine-type recombinase/integrase | - |
NP446_RS24365 (NP446_24365) | 5142694..5143986 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
NP446_RS24370 (NP446_24370) | 5144245..5145506 | - | 1262 | Protein_4824 | hypothetical protein | - |
NP446_RS24375 (NP446_24375) | 5145508..5145858 | - | 351 | WP_003159569.1 | DUF2523 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 5017357..5152816 | 135459 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12990.74 Da Isoelectric Point: 4.4212
>T252899 WP_003123043.1 NZ_CP101912:c5141236-5140889 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAAFQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEAAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1B1XUZ2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |