Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 2691366..2692408 | Replicon | chromosome |
Accession | NZ_CP101912 | ||
Organism | Pseudomonas aeruginosa strain ATCC 27853 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | NP446_RS13000 | Protein ID | WP_003153636.1 |
Coordinates | 2691833..2692408 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | NP446_RS12995 | Protein ID | WP_003050245.1 |
Coordinates | 2691366..2691836 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP446_RS12960 (NP446_12960) | 2686758..2688176 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
NP446_RS12965 (NP446_12965) | 2688166..2689077 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
NP446_RS12970 (NP446_12970) | 2689074..2689766 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
NP446_RS12975 (NP446_12975) | 2689763..2690161 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
NP446_RS12980 (NP446_12980) | 2690173..2690532 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
NP446_RS12985 (NP446_12985) | 2690549..2690782 | - | 234 | WP_003090170.1 | TIGR03758 family integrating conjugative element protein | - |
NP446_RS12990 (NP446_12990) | 2690779..2691162 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
NP446_RS12995 (NP446_12995) | 2691366..2691836 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
NP446_RS13000 (NP446_13000) | 2691833..2692408 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
NP446_RS13005 (NP446_13005) | 2692426..2693340 | + | 915 | WP_016852809.1 | AAA family ATPase | - |
NP446_RS13010 (NP446_13010) | 2693337..2693807 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
NP446_RS13015 (NP446_13015) | 2693804..2694304 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
NP446_RS13020 (NP446_13020) | 2694304..2695206 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
NP446_RS13025 (NP446_13025) | 2695245..2695970 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 2616802..2738506 | 121704 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T252896 WP_003153636.1 NZ_CP101912:2691833-2692408 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT252896 WP_003050245.1 NZ_CP101912:2691366-2691836 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|