Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-dnstrm_HI1420 |
Location | 4573507..4574098 | Replicon | chromosome |
Accession | NZ_CP101910 | ||
Organism | Pseudomonas putida strain ATCC 12633 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | R9VGK1 |
Locus tag | NP430_RS20615 | Protein ID | WP_016488542.1 |
Coordinates | 4573507..4573809 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A1X0Z573 |
Locus tag | NP430_RS20620 | Protein ID | WP_016498445.1 |
Coordinates | 4573802..4574098 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP430_RS20590 (NP430_20590) | 4569351..4569479 | - | 129 | WP_009683677.1 | PA1414 family protein | - |
NP430_RS20595 (NP430_20595) | 4569604..4570497 | - | 894 | WP_016498450.1 | LysR family transcriptional regulator | - |
NP430_RS20600 (NP430_20600) | 4570604..4571773 | + | 1170 | WP_016498449.1 | MFS transporter | - |
NP430_RS20605 (NP430_20605) | 4571903..4572829 | - | 927 | WP_016498448.1 | DMT family transporter | - |
NP430_RS20610 (NP430_20610) | 4572936..4573331 | - | 396 | WP_016498447.1 | hypothetical protein | - |
NP430_RS20615 (NP430_20615) | 4573507..4573809 | + | 303 | WP_016488542.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP430_RS20620 (NP430_20620) | 4573802..4574098 | + | 297 | WP_016498445.1 | putative addiction module antidote protein | Antitoxin |
NP430_RS20625 (NP430_20625) | 4574185..4574457 | + | 273 | WP_016498444.1 | hypothetical protein | - |
NP430_RS20630 (NP430_20630) | 4574575..4575936 | - | 1362 | WP_016498443.1 | DEAD/DEAH box helicase | - |
NP430_RS20635 (NP430_20635) | 4576040..4577341 | + | 1302 | WP_016498442.1 | mechanosensitive ion channel family protein | - |
NP430_RS20640 (NP430_20640) | 4577458..4578393 | - | 936 | WP_016498441.1 | AEC family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4565584..4584822 | 19238 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11379.12 Da Isoelectric Point: 10.8638
>T252886 WP_016488542.1 NZ_CP101910:4573507-4573809 [Pseudomonas putida]
MKKIESSSFRHWVTGLRDLSARARIISRINRLMEGLPGDVSPVGHGVSELKIHYGPGYRVYFHQTGSTFVILLCGGDKSS
QKRDIKVAHQILRSWRMQND
MKKIESSSFRHWVTGLRDLSARARIISRINRLMEGLPGDVSPVGHGVSELKIHYGPGYRVYFHQTGSTFVILLCGGDKSS
QKRDIKVAHQILRSWRMQND
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | R9VGK1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1X0Z573 |