Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicB(antitoxin)
Location 3985445..3986080 Replicon chromosome
Accession NZ_CP101910
Organism Pseudomonas putida strain ATCC 12633

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag NP430_RS17905 Protein ID WP_218178474.1
Coordinates 3985445..3985606 (+) Length 54 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag NP430_RS17910 Protein ID WP_016498927.1
Coordinates 3985655..3986080 (+) Length 142 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NP430_RS17875 (NP430_17875) 3981014..3982066 + 1053 WP_016498933.1 alpha/beta hydrolase -
NP430_RS17880 (NP430_17880) 3982149..3983042 + 894 WP_016498932.1 LysR family transcriptional regulator -
NP430_RS17885 (NP430_17885) 3983220..3983939 + 720 WP_016498931.1 SOS response-associated peptidase family protein -
NP430_RS17890 (NP430_17890) 3983968..3984288 + 321 WP_016498930.1 hypothetical protein -
NP430_RS17895 (NP430_17895) 3984389..3985074 - 686 Protein_3505 putative metallopeptidase -
NP430_RS17900 (NP430_17900) 3985120..3985362 + 243 WP_080642775.1 Pathogenicity locus -
NP430_RS17905 (NP430_17905) 3985445..3985606 + 162 WP_218178474.1 type II toxin-antitoxin system HicA family toxin Toxin
NP430_RS17910 (NP430_17910) 3985655..3986080 + 426 WP_016498927.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NP430_RS17915 (NP430_17915) 3986337..3986699 - 363 WP_016498926.1 hypothetical protein -
NP430_RS17920 (NP430_17920) 3987001..3987363 - 363 WP_016498925.1 VOC family protein -
NP430_RS17925 (NP430_17925) 3987717..3987914 - 198 WP_016498924.1 hypothetical protein -
NP430_RS17930 (NP430_17930) 3987941..3988825 - 885 WP_016498923.1 hypothetical protein -
NP430_RS17935 (NP430_17935) 3988822..3989715 - 894 WP_016498922.1 hypothetical protein -
NP430_RS17940 (NP430_17940) 3989786..3990265 - 480 WP_016498921.1 hypothetical protein -
NP430_RS17945 (NP430_17945) 3990596..3990937 - 342 WP_016498920.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 3982149..3999481 17332


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(14-52)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(4-66)


Sequences

Toxin        


Download         Length: 54 a.a.        Molecular weight: 6112.13 Da        Isoelectric Point: 10.8223

>T252884 WP_218178474.1 NZ_CP101910:3985445-3985606 [Pseudomonas putida]
MIVHKWSSDCRKSANGSHFKIRYKDRQTIFPSHGSKEIGEGLWKAIIKQLGLK

Download         Length: 162 bp

Antitoxin


Download         Length: 142 a.a.        Molecular weight: 15264.38 Da        Isoelectric Point: 4.7662

>AT252884 WP_016498927.1 NZ_CP101910:3985655-3986080 [Pseudomonas putida]
MYDYKIVVHEENDHFWSSCPDIPEAHSVGDSLEELLANAVDGLTLALSIYVDQKRAIPPATEAGDHIVRLSGVTVAKIAL
WNELVRSGKTRADLASMLGISPTAAGRLVDFEHTSKLESLEEALAKFGVRLQVIPTALQAA

Download         Length: 426 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References