Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicB(antitoxin) |
Location | 3985445..3986080 | Replicon | chromosome |
Accession | NZ_CP101910 | ||
Organism | Pseudomonas putida strain ATCC 12633 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | NP430_RS17905 | Protein ID | WP_218178474.1 |
Coordinates | 3985445..3985606 (+) | Length | 54 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | NP430_RS17910 | Protein ID | WP_016498927.1 |
Coordinates | 3985655..3986080 (+) | Length | 142 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP430_RS17875 (NP430_17875) | 3981014..3982066 | + | 1053 | WP_016498933.1 | alpha/beta hydrolase | - |
NP430_RS17880 (NP430_17880) | 3982149..3983042 | + | 894 | WP_016498932.1 | LysR family transcriptional regulator | - |
NP430_RS17885 (NP430_17885) | 3983220..3983939 | + | 720 | WP_016498931.1 | SOS response-associated peptidase family protein | - |
NP430_RS17890 (NP430_17890) | 3983968..3984288 | + | 321 | WP_016498930.1 | hypothetical protein | - |
NP430_RS17895 (NP430_17895) | 3984389..3985074 | - | 686 | Protein_3505 | putative metallopeptidase | - |
NP430_RS17900 (NP430_17900) | 3985120..3985362 | + | 243 | WP_080642775.1 | Pathogenicity locus | - |
NP430_RS17905 (NP430_17905) | 3985445..3985606 | + | 162 | WP_218178474.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
NP430_RS17910 (NP430_17910) | 3985655..3986080 | + | 426 | WP_016498927.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
NP430_RS17915 (NP430_17915) | 3986337..3986699 | - | 363 | WP_016498926.1 | hypothetical protein | - |
NP430_RS17920 (NP430_17920) | 3987001..3987363 | - | 363 | WP_016498925.1 | VOC family protein | - |
NP430_RS17925 (NP430_17925) | 3987717..3987914 | - | 198 | WP_016498924.1 | hypothetical protein | - |
NP430_RS17930 (NP430_17930) | 3987941..3988825 | - | 885 | WP_016498923.1 | hypothetical protein | - |
NP430_RS17935 (NP430_17935) | 3988822..3989715 | - | 894 | WP_016498922.1 | hypothetical protein | - |
NP430_RS17940 (NP430_17940) | 3989786..3990265 | - | 480 | WP_016498921.1 | hypothetical protein | - |
NP430_RS17945 (NP430_17945) | 3990596..3990937 | - | 342 | WP_016498920.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 3982149..3999481 | 17332 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 54 a.a. Molecular weight: 6112.13 Da Isoelectric Point: 10.8223
>T252884 WP_218178474.1 NZ_CP101910:3985445-3985606 [Pseudomonas putida]
MIVHKWSSDCRKSANGSHFKIRYKDRQTIFPSHGSKEIGEGLWKAIIKQLGLK
MIVHKWSSDCRKSANGSHFKIRYKDRQTIFPSHGSKEIGEGLWKAIIKQLGLK
Download Length: 162 bp
Antitoxin
Download Length: 142 a.a. Molecular weight: 15264.38 Da Isoelectric Point: 4.7662
>AT252884 WP_016498927.1 NZ_CP101910:3985655-3986080 [Pseudomonas putida]
MYDYKIVVHEENDHFWSSCPDIPEAHSVGDSLEELLANAVDGLTLALSIYVDQKRAIPPATEAGDHIVRLSGVTVAKIAL
WNELVRSGKTRADLASMLGISPTAAGRLVDFEHTSKLESLEEALAKFGVRLQVIPTALQAA
MYDYKIVVHEENDHFWSSCPDIPEAHSVGDSLEELLANAVDGLTLALSIYVDQKRAIPPATEAGDHIVRLSGVTVAKIAL
WNELVRSGKTRADLASMLGISPTAAGRLVDFEHTSKLESLEEALAKFGVRLQVIPTALQAA
Download Length: 426 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|